Tag: "against" at medical news

Researchers from the University of Navarra analyze new kinds of cancer-fighting antibodies

...stem cells in order to provoke a stronger reaction against cancer. This has the advantage of exploiting a mechanism with an action distinct from the other strategies currently being used to treat cancer, and is capable of interacting with the current treatments so as to make both forms of treatment more powe...

Sunny days pose risk of 'flicker illness' for a few airlifted patients

... of patients. Personnel ought to know how to guard against it." The case report details an account of a patient who suffered a severe foot injury and required an airlift from a remote geographic location to a hospital in Baltimore, where Cushman worked at the time. Flight paramedics noted flickering burst...

Emory algorithm improves kidney transplant chances for sensitized patients

.... Sensitized patients have developed antibodies against human leukocyte antigens (HLAs), which play an important role in the body's immune response to foreign tissue. These patients represent one-third of the national waiting list for kidney transplant patients (50 percent in Georgia), but they only rece...

Chronic disease management quality improvement efforts yield better care delivery

...ame period after the intervention, and judged them against external control centers for comparison. They found a number of process improvements: A 21 percent increase in foot examinations for patients with diabetes. A 14 percent increase in the use of anti-inflammatory medication for patients with ...

Prioritizing women's health

... of the Elimination of All Forms of Discrimination against Women, and 189 countries have agreed an action plan resulting from the Fourth World Conference on Women in Beijing. Yet despite this progress "women's health rights continue to be neglected by the international community, and no more so than in t...

How T lymphocytes attack

...ancer" Unit at Institut Curie. Our body's defences against an infection or tumour are based on a string of actors, some of them generalists, the others highly specialised. Cytotoxic T lymphocytes belong to the second category. To achieve their task, their cell surface carries a membrane receptor which is c...

USC-led study suggests exercise reduces risk of developing invasive breast cancer

...eational physical activity plays a protective role against invasive and in situ breast cancer. "Previous studies have linked physical activity with a reduction in breast cancer, but few studies have examined risk separately for in situ and invasive breast cancers or have characterized risk by hormone recep...

What do we know about asthma in Africa?

...eas where Buruli ulcer is endemic can protect mice against the disease's characteristic skin lesion and might...in P, Marot A, Wondje CM, et al. (2007) Protection against Mycobacterium ulcerans lesion development by exposure to aquatic insect saliva. PLoS Med 4(2): e64. ...

Opening windows effective way of preventing transmission of TB

...ay therefore provide the most effective protection against airborne infection in low resource settings," says Dr Escombe. "Old-fashioned clinical areas with high ceilings and large windows provided the greatest protection. Mechanically ventilated negative-pressure isolation rooms are very expensive to instal...

Drug treatment improves learning in mice with Down syndrome symptoms, Stanford/Packard study shows

... and Fernandez both strongly cautioned individuals against experimenting with the compound or others like it on their own. Appropriate doses and schedules have not yet been determined for humans, and the purity and safety of similar over-the-counter concoctions are questionable. Finally, they emphasized that...

Medicalize me: Experts look at how our perceptions of illness are shaped

...ormalcy and wellness. But the authors also warn against painting this phenomenon with an entirely negative brush. The same drugs that treat deviances from social norms also help many people live their lives, they write. While the old definition of medicalization painted patients as the victims, the new mo...

Cancer drug can extend survival in patients with deadly brain tumors

... marks the first time that Avastin has been tested against brain tumors, the researchers said. The drug, whose chemical name is bevacizumab, currently is used to treat lung and colorectal cancers. The researchers tested the effectiveness of Avastin in conjunction with a standard chemotherapy agent in patie...

New research may overturn conventional wisdom on drug-resistant tuberculosis

...w strain that is already drug-resistant, sometimes against multiple drugs. The authors of the new study, Qian Gao, PhD, and coworkers in Shanghai, China and elsewhere, used molecular genetics and drug susceptibility testing to investigate patients with TB who were treated in Shanghai hospitals during 1999...

Panel presents Agricultural Biosecurity & Sustainability Strategies at 2007 AAAS Meeting

... Effective measures to protect crops and livestock against natural or weaponized pathogens, and to respond to such pathogens, are needed to ensure economic and food security, as well as human health. A panel of experts will discuss the status of current domestic and international agricultural biosecurity ...

RNAi shows promise in gene therapy, Stanford researcher says

...ases. "We've worked on a gene therapeutic approach against viral hepatitis for about 10 years and this is the first thing we've done that really looks promising," said Kay, professor of genetics and of pediatrics at the Stanford University School of Medicine. Kay will talk about future uses for RNAi gene t...

Tobacco companies obstructed science, history professor says

...os and even the keeping of birds. Denying the case against tobacco was "closed," they called for more researc...moking and any charges of fraud for their campaign against the link between cancer and cigarettes. "But if they were lying and if people actually believed th...

Public health and pandemic flu preparedness to headline Preventive Medicine 2007

...e political climate in securing our nations health against a pandemic flu outbreak and explore the roles and functions of national, state, and local governments in collaborative efforts to prepare and respond to pandemic flu. Following that discussion, RADM Kenneth P. Mortisugu, MD, MPH, Acting Surgeon Ge...

SCAI expert panel sets high standards for PCI without on-site cardiac surgical backup

...ite cardiac surgery, the 2005 guidelines recommend against the practice, rating it a Class III indication, as did an earlier set of guidelines issued in 2001. Many studies have shown that PCI is a highly effective treatment for heart attack and offers key advantages over clot-busting drugs. Rapid treatment...

ACS News Service Weekly PressPac -- January 31, 2007

... to damping technology to help stabilize buildings against earthquakes. ER and MR fluids change instantly and reversibly from a free-flowing liquid to a semi-solid with controllable strength in response to an electric or magnetic field, respectively. PR fluids are designed to accomplish the same feat us...

Exercise has no effect on risk of knee osteoarthritis

...erweight, and found that exercise neither protects against nor increases the risk of knee OA. Led by David ...ults who do not have OA, exercise does not protect against disease development," the authors state. The study attempted to examine all the ways in which OA m...

1 2 3 4 5 6 7 8 9 10

(Date:8/21/2014)... BLOOMINGTON, Ind. -- A new study of American ... partner, men have the highest orgasm rates. On ... time, with their sexual orientation making little difference. ... On average, women experience orgasm 62.9 percent of ... -- and this pattern varies with women,s sexual ...
(Date:8/21/2014)... unknown process for harvesting energy and producing oxygen from ... University scientist has discovered. The discovery lays the foundation ... energy from the Sun, and understanding dense blooms like ... worldwide. A paper describing the discovery will be published ... journal Science on 21 August 2014. , ...
(Date:8/21/2014)... to dandruff, eczema and other itchy, flaky maladies in ... reachesincluding Hawaiian coral reefs and the extreme environments of ... in the scientific journal PLOS Pathogens considers ... the genus Malassezia in light of new ... the world. , University of Hawai,i at Mānoa scientist ...
Breaking Biology News(10 mins):Orgasm rates for single women less predictable than men's, vary by sexual orientation 2Orgasm rates for single women less predictable than men's, vary by sexual orientation 3Orgasm rates for single women less predictable than men's, vary by sexual orientation 4Hot-spring bacteria reveal ability to use far-red light for photosynthesis 2Hot-spring bacteria reveal ability to use far-red light for photosynthesis 3From dandruff to deep sea vents, an ecologically hyper-diverse fungus 2
Other Tags
titantedstinkyhypertensivesdiesellaybeachremovesaceseekpreliminarymitralagesfactquotationsretarded