Tag: "all" at medical news

OHSU researchers demonstrate how Alzheimer's disease impacts important brain cell function

...such as reasoning, planning, and abstract thought all affected by Alzheimer's this finding appears to be significant. Furthermore, we noticed that synaptic protein levels were even lower in the brains of patients in the early stages of Alzheimer's disease. This suggests to us that the loss of these im...

Study: Level I trauma centers boost head injury survival

...ave trauma surgeons, anesthesiologists, nurses and all surgical subspecialties, including cardiac surgery...ers." The results of the study do not suggest that all patients should be transferred to level I centers instead of level II centers, or that level II cent...

People with peanut allergy at risk of allergic reaction to lupin flour

...est that people with a peanut allergy should avoid all products containing lupin flour until they can be ...be pre-sensitised. They should be advised to avoid all products containing lupin until they can be specifically tested."...

Belgium doctors treating critically ill infants favour legalising euthanasia

...nd colleagues looked at the death certificates for all neonates and infants in the whole of Flanders who died between August 1999 and July 2000. 292 children were born alive and died in Flanders within the first year of life over this period. 175 doctors in charge of these cases were identified and sent ...

UK approval procedures will drive research overseas

...trusts. Obtaining research governance approval for all 20 trusts required 103 days. With the addition of the 47 days taken to obtain ethical approval, this resulted in a total delay of 150 days. Research studies requiring multiple NHS sites should build in substantial lag times before research processes ...

Lupus and the role of Epstein-Barr virus

...lood samples and medical records were obtained for all participants. Among both lupus patients and controls, African Americans had a higher prevalence of EBV-IgG antibodies the telltale sign of having a history of EBV infection than white subjects. However, another antibody, EBV-IgA, seen with repeat ...

Lack of vigorous activity linked to functional decline in older adults with arthritis

...rchers are seeking to understand better and manage all the components demographic, biological, socioecon...unctional limitation. The research team evaluated all participants for a wide range of risk factors, including age, education, income level, and the toll ...

IOM report should end nevirapine controversy, HIVMA says

... in the Philippines, Cambodia, and India. "Now we all need to turn our attention to getting the best available anti-AIDS drugs to the millions who need them, including pregnant women." In its review of HIVNET 012, a study on single-dose nevirapine conducted in Uganda in the late 1990s funded by the Nati...

Institute of Medicine news: Review of HIVNET 012 study

...e trial database. In some instances, however, not all serious adverse events that occurred simultaneousl...ralize the study's total rate of adverse events to all settings. Other settings -- such as countries with lower rates of endemic diseases -- may have diff...

OHSU develops instant, computerized notification system to communicate patients' end-of-life wishes

... or traumatic injury -- in these cases, initially, all emergency medical treatments are provided. If patients are unable to make their wishes known because an injury to the brain is severe and prolonged, health professionals look for an advance directive to find out who the patient has appointed to speak...

Liver may be source of 'good' cholesterol

...ne (ABCA1) involved in the production of HDL. Like all genes, ABCA1 exerts its effects through a protein that it manufactures. The ABCA1 protein is found in many parts of the body, so scientists have been unsure which specific tissues are involved in HDL production. They suspected the liver played an imp...

Data show cyclosporine inhalation solution improves long-term survival in lung-transplant patients

...pies. Enrollment was completed in August 2001, and all subjects were followed until study completion in A...per week for two years. Upon completion of dosing, all subjects were followed for efficacy, including chronic rejection and survival, until the last enroll...

OHSU scientist helping explain basis of psychotic behavior

...e is that there are a lot of different things that all seem to converge on this system," Grandy said. "It's like all roads lead to Rome. The D2 system still seems to be very important in terms of psychosis and ampheta...

About 70 percent of older adults use alternative medicine

...002, found a lower rate -- about 62 percent among all adults. "The percentage of older adults who used a...s showed Blacks, widows, and more religious people all tended to use alternative medicine more often than did other older adults. Other results were more r...

Fifteen-year hunt uncovers gene behind 'pseudothalidomide' syndrome

...gment of a gene called ESCO2 that was identical in all the animals contained changes that disrupted the gene's protein-making instructions in people with the syndrome. Knocking out the equivalent gene in yeast and fruit flies led to the same chromosome problems, says Gordillo. "Comparative genomics didn...

Two drugs combined more cost-effective safer for managing arthritis in high-risk patients

...2 inhibitors were not a health economic bargain at all -- especially given the added costs of more heart attacks." More than 15 million Americans suffer from chronic arthritis, including osteoarthritis and rheumatoid arthritis. According to researchers, non-steroidal anti-inflammatory drugs are the most...

Blood test can accurately diagnose heart failure in emergency patients

...s' symptoms were caused by heart failure, based on all available information except the NT-proBNP assay. ...ogists not involved in the patients' care reviewed all the participants' relevant hospital records from the initial emergency visit through the 60-day foll...

Nature provides inspiration for important new adhesive

...icle board, and laminated veneer lumber products - all major components of home construction and many other uses. One of these patented adhesives is currently cost-competitive with a commonly used urea-formaldehyde resin, researchers say, but does not use formaldehyde or other toxic chemicals. Formalde...

In years preceding medicare eligibility, many older adults at risk of being uninsured

...continuously enrolled in private insurance through all five interviews. Women, African American and Hispa...and being uninsured at the start of the study were all associated with higher risk of death. "The proportion of U.S. adults in late middle age at risk from...

New recommendation encourages more activist approach to lung cancer screening

...mal. Moreover, the data demonstrate that virtually all long-term survivors following the diagnosis of lung cancer were those who had undergone complete surgical removal of the tumor. In addition, the authors noted that innovations in imaging technologies in the past decade, such as CT scanning and more ...

1 2 3 4 5 6 7 8 9 10

(Date:4/17/2014)... hundred births, Down syndrome - or trisomy 21 - ... It results from a chromosomal abnormality where cells of ... (1% of the human genome). A study conducted by ... Genetic Medicine and Development at the University of Geneva ... shed light on how the extra chromosome 21 upsets ...
(Date:4/17/2014)... Clemson professor Rajendra Singh Thursday as a "Champion ... expand solar deployment in the residential, commercial and ... Professor of Electrical and Computer Engineering and director ... a local hero leading the charge across the ... solar power and driving policy changes at the ...
(Date:4/17/2014)... such as heart disease, epilepsy and pain, making them ... is still much scientists do not know about the ... into the structure of sodium channels and, specifically, one ... responsible for ,fine-tuning, the activity of the channel. The ... the Journal of Biological Chemistry . , Nerves ...
Breaking Biology News(10 mins):Trisomy 21: How an extra little chromosome throws the entire genome off balance 2Trisomy 21: How an extra little chromosome throws the entire genome off balance 3White House honors Clemson professor as 'Champion of Change' for solar deployment 2Structure of sodium channels different than previously believed 2
Other Tags
architectsbeaverrunawaycaspaseclindamycinplentifulpertussisimmunogenicityallergenillnessessupplementsherbalprofessorshipbassetspaceddocument