Tag: "beyond" at medical news

A 'broader' look at cardiac CTA images often finds diseases/disorders beyond the heart

...l unsuspected and potentially significant findings beyond the heart, according to a recent study conducted by researchers at the University of Maryland School of Medicine, located in Baltimore, MD. Our interest in this topic developed because we were performing many cardiac CTA examinations, including th...

New treatment boosts muscle function in myasthenia gravis

... Experts say this discovery may have implications beyond myasthenia gravis. Oral antisense may become another mode of therapy in neuromuscular disease and further study is needed, said Argov. However, these preliminary results should be evaluated with caution since this was an open label study. Argov s...

Pot bellies linked to early signs of cardiovascular disease

...hat other measures of obesity did not discriminate beyond traditional risk factors, whereas WHR did. The results are most astonishing and may be influenced by the age distribution of the study, Dr. Erbel added. During life, the likelihood of coronary artery calcium increases more in men than in women. It ...

MRI finds breast cancer before it becomes dangerous

...rade DCIS is relatively inert and may never spread beyond the milk duct (and thus may never pose a threat to the women affected), high-grade DCIS will virtually always break out of the milk ducts, and then will become dangerous, biologically aggressive high grade invasive breast cancer. This makes it all t...

Most seniors now have drug coverage, U-M study shows

... Retirement Study, the researchers were able to go beyond the official statistics to show that rich and poor were equally likely to sign up for Part D and private coverage, and to lack coverage. Wealthy elders were much more likely to have employer-provided drug coverage, but poorer seniors were much more l...

Hormone regulates fondness for food

...olling eating behaviour and will hopefully take us beyond some of the prevailing and simplistic assumptions about why some people have difficulties in controlling how much they eat. Such understanding will be a key step in the prevention and treatment of obesity. Importantly, the finding that the liking ...

States taking action to insure nation's 13.3M uninsured young adults

...pendent young adults on their parents health plans beyond age 18 or 19, according to a new report from The C...e State Childrens Health Insurance Program (SCHIP) beyond age 18 would be an important policy solution to cover this group, the authors say. The SCHIP reautho...

Early-childhood intervention may improve well-being through young adulthood

...e fact that positive results of the program extend beyond educational achievements is not surprising given the links between education, mental and physical health and behavior, the authors note. Because expenditures for the medical care and justice systems comprise roughly 20 percent of the gross domestic p...

U of M report says early-childhood intervention improves well-being through young adulthood

...e fact that positive results of the program extend beyond educational achievements is not surprising given the links between education, mental and physical health and behavior, Reynolds and Temple said in the study. Because expenditures for the medical care and justice systems comprise roughly 20 percent of...

The matrix of autism

...oblem solving, their intelligence clearly goes far beyond rote memory and perception to include complex reasoning ability. That won't come as any surprise to Michelle Dawson, who is autistic. She is also a scientific collaborator on this study....

Obese girls less likely to attend college

...se results indicate the harmful effects extend far beyond physical health," said Robert Crosnoe, author of the study and a sociologist at the university. Crosnoe suggests a number of mental health and behavioral issues seem to play a significant role in keeping obese girls from enrolling in college. The ...

UD scientists invent novel hydrogels for repairing, regenerating human tissue

...or cells extends the uses of these biopolymers far beyond soft-contact lenses into an intriguing realm once viewed as the domain of science fiction, including growing bones and organs to replace those that are diseased or injured. This is an area that will be exploding over the next decade, Pochan said. ...

Scaling up HIV prevention programs is cost effective

...ts. But there is a threshold. When projects expand beyond a certain point, costs can start to rise an effect noted in 2 types of HIV prevention interventions in India. As more PANCEA-type data becomes available, researchers will be better able to predict these changes. The global HIV prevention effort i...

A new direction: Integrating best-practices to improve food responses

...re holistic way will allow us to broaden responses beyond just food, he says. An integrated information system that incorporates analysis of baseline vulnerabilities of households, monitors household trends, and considers alternative responses will provide the evidence base for improved decision making and ...

Researchers develop criteria to detect bone mass deficiencies in children with chronic diseases

...20s, although this study did not evaluate patients beyond the age of 17. Another key finding shows differences in bone density between African American and non-African American children. African American children on average have greater bone density and are less susceptible to fractures. Dr. Kalkwarf said t...

Metabolic syndrome points to heart health

... may help predict an increased cardiovascular risk beyond that predicted by the more frequently used Framingham risk score, Azevedo says....

Heading to Siberia: UH signs agreement with Russian Academy of Sciences

...ll allow enhanced research collaboration in fields beyond the current geosciences and materials sciences efforts, Ignatiev said. This arrangement opens up further opportunities for UH of not only research collaboration with the highly regarded Russian Academy of Sciences, but also the exchange of students ...

Research probes seniors' plans for end-of-life care

... wishes for end-of-life medical treatment. Yet, beyond headline-grabbing cases such as Schiavo's, what truly motivates people to plan for medical care at life's end" With record numbers of Americans - the Baby Boom generation - now reaching age 60, we still know surprisingly little about these decisions ...

Performance-related financial incentives for hospitals not linked with improved quality of care

...easures and outcomes for treatment of heart attack beyond that in hospitals not participating in the quality-improvement program. The study included an analysis of data for 105,383 patients with acute non-ST-segment elevation myocardial infarction (a certain pattern on an electrocardiogram following a heart...

Extra pay does not improve hospital performance

...f care or outcomes for patients with heart attacks beyond that seen with voluntary quality improvements. There are three important messages from this study, said cardiologist Eric Peterson, M.D., senior member of the research team. On one hand, the data showed that care is improving overall in the United ...

1 2 3 4 5 6 7 8 9 10

(Date:5/16/2013)... -- Injectable nanoparticles developed at MIT may someday ... diabetes to constantly monitor their blood-sugar levels and ... designed to sense glucose levels in the body ... insulin, thereby replacing the function of pancreatic islet ... 1 diabetes. Ultimately, this type of system could ...
(Date:5/16/2013)... relationship between the heritable risk for schizophrenia and ... is commonly associated with cognitive impairments that may ... IQ may be linked to the risk for ... precede the onset of schizophrenia symptoms. Also, these ... people diagnosed with schizophrenia. , In a remarkable ...
(Date:5/16/2013)... May 16, 2013 Integrated Biometrics patented ... a custom thin film transistor camera introduces Sherlock, ... roll image in the smallest and lightest form ... Appendix F Mobile ID FAP 45, Certified scanner ... in size and weight when compared to optical ...
Breaking Biology News(10 mins):Nanotechnology could help fight diabetes 2Nanotechnology could help fight diabetes 3Genetic risk for schizophrenia is connected to reduced IQ 2
Other Tags
sarawakmalaysianweevilnicetrendupwardpredisposingemphasiscouricmovieadvisestraymitigatesolicitousnessgastroenteritisgatorade