Tag: "buds" at medical news

Music helps patients tune out test anxiety

...ection of available CDs. Before the procedure, ear buds were taped to all of the participants' ears and volume set to be audible to only the patient. After the patient received his or her initial dose of medication, an investigator opened a randomized envelope to see if the music selections would be pl...

Dr. McCluskey receives top honor for young taste researchers

...ical College of Georgia neuroscientist using taste buds as a model for studying nerve regeneration, is the...n the complex system connecting thousands of taste buds on the tongue and palate with the brain. "Receptor cells on your tongue are part epithelial cells: t...

Sweet chemistry: Symposium explores sugar alternatives, science of taste

....m.) Wednesday, March 29 Tricking the taste buds with sweetness enhancers Researchers at Senomyx, Inc. in La Jolla, Calif., are developing compounds that can enhance sweetness or saltiness by activating or blocking certain taste receptors. The compounds, which could help reduce the amount of suga...

1

(Date:10/16/2014)... Post-menopausal women experienced improvements in vaginal atrophy, with ... bleeding, after 12 weeks of daily 10 milligram ... nutritional supplement previously shown to help relieve certain ... study reported in a poster at the North ... , "These data documented improved vaginal epithelium, without ...
(Date:10/15/2014)... has admitted Johannes Gutenberg University Mainz (JGU) as ... hub continues to maintain a significant nationwide standing ... "The acceptance of Johannes Gutenberg University Mainz as ... milestone in the national and international competition for ... of Rhineland-Palatinate can be proud that Mainz University ...
(Date:10/15/2014)... 15, 2014   Neurotechnology , a provider ... availability of the VeriLook Surveillance 3.0 software ... real-time biometric face identification using live video streams ... The new version not only identifies faces in ... objects while they are moving through the video ...
Breaking Biology News(10 mins):S-equol supplements associated with improved measures of reproductive health in postmenopausal women 2Johannes Gutenberg University Mainz joins Germany's Gauss-Allianz as a full member 2Johannes Gutenberg University Mainz joins Germany's Gauss-Allianz as a full member 3VeriLook Surveillance 3.0 SDK Identifies Faces and Moving Objects, Differentiates Pedestrians from Other Moving Objects in Video Surveillance Systems 2VeriLook Surveillance 3.0 SDK Identifies Faces and Moving Objects, Differentiates Pedestrians from Other Moving Objects in Video Surveillance Systems 3
Other Tags
doublecortindirectingpayloadsstsmaintenancetelomerealivedrunkenapplesdevicewidelyisraeliimpactmonitoringneurodegenerativeions