Tag: "bullet" at medical news

Pediatricians must confront community-based threats to health

...ially available A surgeon may be able to extract a bullet from a wound, but is unable to remove the victim from the environment of failing schools, gangs, drugs, violence, and struggling families that constitute the culture of poverty. Such obstacles to health require pediatricians to expand their roles to...

Study reveals hormone can reduce food intake, body weight

...is study, the hormone does not seem to be a silver bullet to fight obesity," said Michael Cowley, Ph.D., an assistant scientist in the Division of Neuroscience at ONPRC. "The decreases in appetite only occurred during meals early in the day. However, PYY did not affect food intake in the evening. In additio...

'Visible Proofs' exhibition on forensic medicine opens at NIH

...s, dating back to the 1600s A human heart with a bullet hole in it, a stomach poisoned by arsenic, and a kidney punctured by a fatal knife wound The famous "Nutshell Studies" dollhouse crime scenes, based on true cases and created in the 1940s as a forensic teaching tool Fingerprints from the first in...

Mailman school researchers studying link between obesity and the urban environment

...ccumulate toward us getting fat. There is no magic bullet that will curb the rise in obesity. And that is why it's so hard to fight the epidemic. You don't have one target to hit, you have one thousand targets to strike to win."...

New strategy developed to study disease: Reveals insights into cancer and treatment leads

...nic myeloid leukemia, is the most successful magic bullet against cancer in many years and works by blocking tyrosine kinase activity," Cole says. As a next step, Cole and his colleagues plan to further examine the role of Src in cancer using their new model. They also plan to adapt the approach to develo...

How should countries best respond to a flu pandemic?

...aid: "The modelling shows there is no single magic bullet which can control a flu pandemic, but that a combination of interventions could be highly effective at reducing transmission, potentially saving many lives." The research shows that border restrictions are unlikely to delay the spread of influenza b...

M. D. Anderson: Setting the benchmark in brain tumor treatment

...ely be a bumpy one. "There will be no magic bullet to treat brain cancer," says Raymond Sawaya, M. D., professor and chair of the Department of Neurosurgery. "The answer is not going to come from one approach. We have to test and prefect many different avenues for treatment, and hit the right combina...

Boosting key protein in brain could improve seizure treatment, Stanford study finds

..., then we can hopefully counteract it with a rifle bullet rather than a shotgun that causes all kinds of side effects." Brill made the discovery about VPA while working with rats. Increases of neuropeptide Y had been observed in rodent brains in response to seizures, and injections of the peptide had been...

How to lose weight and not go hungry: HU researcher develops drug that mimics feeling of 'fullness'

...r suffer today from obesity, yet there is no magic bullet that has yet provided a universally accepted solution. However, a young researcher at the Hebrew University of Jerusalem feels he has come up with a practical weight loss solution for the obese person without his having to feel hungry. For this de...

1

(Date:7/25/2014)... molecular testing panel developed at UPMC greatly increases ... for patients with thyroid nodules and cancer, report ... (UPCI), partner with UPMC CancerCenter., The test, available ... diagnostic testing agencies, improved the chances of patients ... according to the study published this month in ...
(Date:7/24/2014)... Scientists at The New York Stem Cell ... to creating a viable cell replacement therapy for ... , For the first time, NYSCF scientists generated ... samples of patients with primary progressive multiple sclerosis ... induce these stem cells into becoming oligodendrocytes, the ...
(Date:7/24/2014)... , July 24, 2014 /PRNewswire-iReach/ -- The Geneva ... from cardiac devices, has cut emergency room wait times ... San Diego (UCSD) Medical Center, according to a recent ... UCSD Emergency Departments are using the suite to access ... pacemakers or defibrillators. "Using Geneva,s technology platform ...
Breaking Biology News(10 mins):Test increases odds of correct surgery for thyroid cancer patients 2Test increases odds of correct surgery for thyroid cancer patients 3NYSCF scientists one step closer to cell therapy for multiple sclerosis patients 2UC San Diego Medical Center Cuts Average ER Wait Time by 92 Minutes using the Geneva Healthcare Suite 2UC San Diego Medical Center Cuts Average ER Wait Time by 92 Minutes using the Geneva Healthcare Suite 3
Other Tags
historyevolutionarysalamanderrewritesbrewsphysicistsmillipedescavechemoembolisationpfilegatomariannepersonalizedheaviertvsenlargement