Tag: "cancerous" at medical news

Pezcoller Foundation-AACR International Award for Cancer Research

... cells were stimulated with growth factors or made cancerous with oncogenes. In addition, genetic evidence ind... critical event in transforming a normal cell to a cancerous cell. In 1992, Cantley moved to Harvard Medical School and Beth Israel Deaconess Hospital, wher...

Early stage breast-cancer rates are rising as incidence of invasive cases are leveling

...cs. If left untreated, DCIS may, over time, become cancerous and begin to spread, or invade, the surrounding milk ducts. "Given that rates of DCIS and LCIS continue to increase in the United States, clinically useful tools that improve our abilities to stratify these patients based on their risk of invasive c...

'Nanoshells' simultaneously detect and destroy cancerous cells

...noscale particles that can both detect and destroy cancerous cells. The report appears in the April 13 issue o...]," says Drezek. "We don't want to simply find the cancerous cells. We would like to locate the cells, be able to make a rational choice about whether they need ...

Cancer research could lead to improved detection methods

...ance that a precancerous lesion will progress to a cancerous one. Dr Liloglou continued: "We have shown that early lesions that are virtually undetectable with current clinical methods carry molecular changes or mistakes that may commit cells to develop into a tumour." "Our study emphasizes the need to develop...

Spice it up or just veg out, either way you may be helping to defend against cancer

...ing benefit by slowing or preventing the growth of cancerous tumor cells. The findings, being presented at the ...nduced apoptosis, or programmed cell death, in the cancerous cells without affecting normal pancreatic cells. "Our results demonstrate that capsaicin is a pote...

'Virtual colonoscopy' effective in finding most polyps but may miss small ones

... can, but it may miss some smaller yet potentially cancerous growths, according to a new review of studies. The...he virtual colonoscopy. Most colon polyps are not cancerous or become malignant so slowly that an individual will die of other causes before colorectal cancer d...

Nanoparticles offer new hope for detection and treatment

Specially designed nanoparticles can reveal tiny cancerous tumors that are invisible by ordinary means of det...as they carry the imaging materials that spotlight cancerous growth. "One of the best advantages of the particles is that we designed them to detect tumors using...

Breast cancer detector that uses electricity instead of X-rays under study

...on evidence that electrical current passes through cancerous tissue more easily than normal tissue. Preliminary studies have shown the technique, which takes about 10 minutes and doesn't require often-uncomfortable breast compression, can pick up very small tumors, according to its developers, Z-Tech, Inc., wh...

Tumor detection, data encryption to benefit from UH research

...y aid doctors in detecting and surgically removing cancerous cells in the body. "Among many other applications, quantum dots can be used as biological labels," Sharma said. "For example, one can suitably tailor the size and bio-treatment of a dot so that it preferentially seeks and attaches to tumor cells....

New procedures more accurate in early diagnosis of GI cancers

...nditions based on targeted biopsies of potentially cancerous areas. This early detection may help save lives."...

Chemo-radiation therapy treatment gives head-and-neck cancer a 1-2 punch

...ccess of the therapy. Immediately after treatment, cancerous tumors visibly completely disappeared in 80 percent of patients. Researchers followed the patients in the years after treatment, and after an average follow-up of 3.9 years, they estimated a four-year rate of local and regional tumor control of 55 pe...

Antibody combined with cancer drug shows promise against breast tumors

... designed to find and destroy blood vessels within cancerous tumors, cutting off their blood supply. Specifically, mice with human breast tumors treated with 3G4 and docetaxel had a 93 percent reduction in overall tumor growth. The injected breast cancer cells also stimulated the growth of tumor colonies in th...

American Thoracic Society Journal news tips for May 2005 (second issue)

...ly explained by lower rates of surgical removal of cancerous tissue (surgical resection) among the Hispanics and a higher probably of being diagnosed at the more advanced IB stage for lung cancer. According to the investigators, lung cancer is the leading cause of death among Hispanic men and the second leadin...

Statin use associated with reduced risk of pancreatic and esophageal cancers

... studies have shown that statins have an impact on cancerous cells by limiting tumor growth in human and animal models. However, the potential benefits of statin use in protection against cancer have not been explored extensively. "We've known for some time that statins provide significant benefit to patient...

New therapy may give options to those with neuroendocrine tumors

...cer cells, but also the blood vessels that nourish cancerous tumors and the tissue that supports tumors in the body. The drug hinders the action of vascular endothelial growth factor and two platelet-derived growth factors. It also interferes with proteins associated with a cancer gene called c-kit. "I've nev...

Study shows Erbitux may fight colorectal cancer after other therapies fail

...fitting into the receptors. EGF gives orders for a cancerous cell to grow, so blocking EGF interferes with growth. Most colorectal cancers express EGFR, and high levels of EGFR are usually associated with more metastases and poor prognosis, Lenz explains. Cetuximab also prevents DNA from being repaired, block...

Zevalin safe and effective for non-Hogdkin's lymphoma patients with advanced disease

..., radiation is added to the antibody to target the cancerous cells to the effects of ionizing irradiation. A major potential benefit to Zevalin is that treatment takes approximately eight days compared to six months of standard therapy. "Patients with non-Hodgkin's lymphoma who have failed standard chemotherap...

Procedure setting, technique and cost are key for effective colorectal cancer screening

... found significant differences in the detection of cancerous polyps among gastroenterologists in their clinical practice. The study population consisted of 2,051 subjects who underwent colonoscopy for colorectal cancer screening in a community-based GI practice. Approximately 90 percent of the screening subje...

New method of administering anti-cancer drug may be more effective, safer

...drug busulfan is used in leukemia patients to kill cancerous cells before bone-marrow transplant. Currently, it is administered in intermittent intravenous doses, typically via two-hour infusions of the drug every six hours. Previous studies have reported that frequent dose adjustments are needed to maintain t...

Obesity is risk factor for aggressive prostate cancer

...was the senior author, looked at 1,106 men who had cancerous prostate glands removed at Veterans Affairs Medical Centers in Augusta, West Los Angeles, San Francisco and Palo Alto, Calif., as well as the San Diego Naval Medical Center from 1988 to 2002. The hospitals comprise the Shared Equal Access Research Ca...

1 2 3 4 5 6 7 8

(Date:6/17/2013)... CORVALLIS, Ore. Amphibian populations are declining worldwide and ... be spread by bullfrogs, but a two-year study shows ... suggestions that bullfrogs are a tolerant carrier host that ... frogs from eggs in controlled experimental conditions, they found ... dendrobatidis , also called Bd or a chytrid fungus, ...
(Date:6/16/2013)... prevention programs for female sex workers in India reduce ... (STIs), a University of Toronto study has found. ... HIV, mostly in the southern states of Andhra Pradesh, ... Professor Prabhat Jha from U of T,s Dalla Lana ... for Global Health Research (CGHR), examined the impact of ...
(Date:6/16/2013)... ago triggered a similar marine ecosystem crisis to those ... warming, according to research published today in Nature ... universities of Newcastle, UK, Cologne, Frankfurt and GEOMAR-Kiel, confirms ... the marine ecosystem during the mid-Cretaceous greenhouse period. ... amplitude and duration of the temperature change.,Analysing the geochemistry ...
Breaking Biology News(10 mins):Bullfrogs may help spread deadly amphibian fungus, but also die from it 2HIV prevention among female sex workers in India reduces HIV and syphilis 2Global cooling as significant as global warming 2
Other Tags
comparablemarimastatketektenthdarklyairwayeditsfluorideappropriationsconveysasmusualunprovengambiaopposeshivma