Tag: "carotid" at medical news

Implanted medical device aims to lower blood pressure

...ally activating the baroreflex system based in the carotid arteries in the neck, regulating blood pressure in...serted under the skin near the collarbone, and two carotid sinus leads, which run from the generator to the left and right carotid sinus in the neck. While imp...

Women not given same tests for stroke

...ography of the heart, brain MRI, ultrasound of the carotid artery, and EKG. There was no difference between m...ty of the strokes. Sixty percent of women received carotid ultrasound, compared to 71 percent of men, Smith said. For echocardiography, 48 percent of women rec...

Increased risk associated with combining carotid artery, coronary artery surgeries

...quently consulted when the patient also has severe carotid artery stenosis (blockage of an artery that suppli...to the brain). In a small number of these cases, a carotid endarterectomy is performed at the same time as the bypass surgery, with the assumption that combini...

Vascular structure and function improve with diet and exercise

...et of LVDF abnormalities. The brachial (arm) and carotid (neck) arteries were tested for intima-media thickness and arterial distensibility. Both reflect the health of the blood vessels. The thicker and less distensible (elastic) the arteries are, the greater the load on the heart. This often results fr...

Diabetes medication pioglitazone HCl may significantly improve predictors of cardiovascular risk

...t the diabetes medication pioglitazone HCl reduced carotid artery intima-media thickness (IMT). Patients tak...h atherosclerotic plaque accumulates. A thickened carotid intima-media layer correlates with not only with the presence of cardiovascular risk factors, but al...

Fluorescence device to diagnose atherosclerosis and tumors described at optics conference

...ed from 34 patients undergoing surgical removal of carotid plaque, with 150 plaque areas analyzed, the TR-LIFS technique has been able to distinguish plaque found in inflamed areas from more stable plaque with a high degree of sensitivity and specificity. Experiments are now being conducted on plaque that e...

Vitamin B12 deficiency as heart risk

...ing homocysteine levels, which are associated with carotid plaque area, a strong predictor of cardiovascular ...ured levels of serum vitamin B12, homocysteine and carotid plaque in 421 patients referred to vascular disease prevention clinics and found that vitamin B12 de...

Mutation in mouse circulatory gene mimics a form of congenital heart disease

...blood vessels, including the pulmonary artery, the carotid artery, and the aorta," notes Parmacek. "These were all consistent with the defects observed later on that caused the embryos not to survive after birth." Overall, the researchers demonstrated that the cardiac neural crest cells that originate in t...

Teen-agers with Type 1 diabetes already developing cardiovascular disease

... at the intima-media thickness (IMT) of the common carotid artery-basically, the thickness of the wall of the main neck artery. That thickness can hint at atherosclerosis progression. Atherosclerosis, an accumulation of cholesterol-containing plaques along the artery walls, can eventually cause heart attack,...

Northwestern Memorial neurologist is lead author of comprehensive stroke center recommendations

...ed surgical and endovascular procedures, including carotid endarterectomy; and Special infrastructure and programmatic elements, such as an intensive care unit and a stroke registry. The panel noted that there are no data yet on a cost-benefit analysis for a CSC. "Individual hospitals will have to develop...

Experts report dental X-rays effectively identify stroke risk factors

... in detecting some cases of clinically significant carotid artery stenosis, or blockages in the carotid artery, which can potentially lead to stroke. The findings were presented by Laurie Carter, DDS, Ph...

Post-stroke tests not used often enough, especially in women

...lots traveling to the brain or by blockages in the carotid arteries in the neck that supply blood to the brai... clots to form in the heart, and the health of the carotid arteries. The results of such tests can guide doctors to prescribe preventive treatment and help pat...

Updated guideline: Carotid endarterectomy beneficial for stroke prevention in some patients

...). The guideline updates the 1990 AAN statement on carotid endarterectomy. Carotid endarterectomy is a surgic...emoves plaque and fatty deposits from blocking the carotid arteries which are the main suppliers of blood for the brain. There is strong evidence recommending ...

Smoking may increase risk of diabetes

...found that increased thickness of the walls of the carotid artery in the neck suggested that insulin resistance might be an independent risk factor for heart disease. Since that report, IRAS investigators have been asking other research questions, based on extensive examinations at the start of the study t...

SCAI, NCQA partner to hold landmark conference on introducing complex medical therapies

...lection and analysis related to the performance of carotid artery stenting (CAS). The conference, funded by a grant from the Agency for Healthcare Research and Quality (AHRQ), will bring together clinical, methodological, and other experts to explore the best options for coordinating the collection and analy...

Three-year SAPPHIRE and US carotid feasibility trials demonstrate durability of carotid stenting

...s meeting, demonstrate the long-term durability of carotid artery stenting (CAS) for the prevention of stroke versus carotid endarterectomy (CEA) in high risk surgical patients. Three hundred thirty-four patients in the SAP...

Diabetic blacks have less coronary artery disease than diabetic whites

...ic plaque in the coronary (heart) arteries and the carotid arteries in the neck that supply blood to the brai...lso observed in the face of increased thickness of carotid artery walls in black diabetic subjects. Increased wall thickness is widely accepted including by t...

Statins reduce the risk of stroke and death after carotid artery surgery

...gs could reduce the risk of stroke and death after carotid surgery, which is the gold standard procedure for patients with severe carotid artery disease at risk of stroke from that disease." Carotid artery disease occurs when the carotid ...

Jefferson scientists uncover more evidence for protein's role in artery blockage

...he smooth muscle cells in mice with a damaged left carotid artery, an experimental condition that fosters the...essive cell growth. But when they injured the left carotid artery in mice with a foreign gene that made extra GRK5 only in the vascular smooth muscle, cell pro...

High tech imaging tells the tale of plaque from the inside out

...ice by identifying the type of plaque found in the carotid arteries, the main blood supply for the brain. They measured 353 plaque areas in the carotid arteries of 50 patients who were scheduled to undergo carotid endarterectomy, a procedure in which t...

1 2 3 4

(Date:8/28/2014)... -- Scientists have identified the developmental on-off switch for ... produce more than two-thirds of the world,s naturally derived ... to see whether it is possible to manipulate this ... , The study, appearing August 28 in Cell ... molecule called cyclic-di-GMP and a larger protein called BldD ...
(Date:8/28/2014)... method for measuring and imaging how quickly blood flows ... understand how drug abuse affects the brain, which may ... lead to better treatment options for recovering drug addicts. ... from Stony Brook University in New York, USA and ... in The Optical Society,s (OSA) open-access journal ...
(Date:8/28/2014)... the first person to alert the world to Global ... be captured and stored underground. He says that Carbon ... the best way to avoid global warming getting out ... (Columbia University, New York) made the call during his ... where 150 scientists are meeting to discuss Carbon Capture ...
Breaking Biology News(10 mins):Small molecule acts as on-off switch for nature's antibiotic factory 2Small molecule acts as on-off switch for nature's antibiotic factory 3This is your brain's blood vessels on drugs 2This is your brain's blood vessels on drugs 3Global warming pioneer calls for CO2 to be taken from atmosphere and stored underground 2
Other Tags
speedycootsovulationperimenopausalpeeksgenesystemsstrepasidewallsbumpdegradationimmunitiesbrandedpolymerpurduesexes