Tag: "congestive" at medical news

Protein's potential as a regulator of brain activity discovered

...itors, such as digoxin, are commonly used to treat congestive heart failure. Agrin may, therefore, have therapeutic value for the treatment of diseases affecting tissues and organs outside of the brain....

Study in Science holds promise for a new approach to drug therapy

...2 of the top 20 selling drugs, including Coreg for congestive heart failure, Cozaar for high blood pressure, Zoladex for breast cancer, Buspar for anxiety and Clozaril for schizophrenia, as well as by Zantac and Claritin. Together the drug class accounts for $200 billion in annual sales. Authors of the current ...

End-of-life treatment preferences may change as health declines

...uctive pulmonary disease (COPD) and 29 percent had congestive heart failure. The patients were interviewed at least once every four months for a period of up to two years. At each interview, researchers assessed the participants' health condition and asked the participants whether they would accept treatment ...

Diuretic may not be best way to reduce CHF water retention

... reduce the excess fluid build-up in patients with congestive heart failure, one that avoids the relative sodium...uretics become part of life for many patients with congestive heart failure, a disease characterized by fluid retention that can lead to shortness of breath, swol...

Smokers seven times more likely to receive jolt from heart devices

...d the risk of death by 23 percent in patients with congestive heart failure. "ICDs are implanted in patients at high risk for sudden cardiac death," Snchez says. "The devices shock the heart out of dangerous rhythms within seconds after they detect them. It's like having a little ambulance in your chest." The s...

Corticosteroid therapy may be associated with irregular heartbeat

... and fluid, which can lead to high blood pressure, congestive heart failure or enlarged atria, all risk factors for atrial fibrillation. "Our findings suggest that patients receiving high-dose corticosteroid therapy are at increased risk of developing atrial fibrillation," the authors conclude. "Therefore, car...

Air pollution increases death risk in people with certain diseases

...etes 28% for people with COPD 27% in people with congestive heart failure 22% for people with inflammatory disease such as rheumatoid arthritis or lupus "The study significantly strengthens evidence that breathing in particulate matter is associated with dying sooner," said researcher Joel Schwartz, Ph.D., ...

Increased nighttime blood pressure may be linked to higher risk for congestive heart failure

... pressure level at night may increase the risk for congestive heart failure, according to a study in the June 28 issue of JAMA. Congestive heart failure (CHF) is one of the most common, costly, disabling, and deadly diseases. Once diagnosed as having CHF, patients have a 1 in 3 chance of dying within 1 year a...

Healing the heart with bone marrow cells

...n transplantation, more than half of patients with congestive heart failure die within five years of initial dia...d others develop progressive and potentially fatal congestive heart failure. "We know that the number of c-kit positive cells decreases with age and that elderly ...

Jefferson scientists show 'miracle' cancer drug Gleevec can be toxic to the heart

...ic myelogenous leukemia (CML) who developed severe congestive heart failure while taking Gleevec, appear July 23, 2006, in an advanced online edition of the journal Nature Medicine. "We found that the molecular target of the drug, the Abelson tyrosine kinase (ABL) protein, serves a maintenance function in car...

CVD patients should be tested for chronic kidney disease

...his includes those with coronary artery disease or congestive heart failure as well as those with CVD risk factors such as diabetes and hypertension. "Cardiovascular patients should ask their cardiologists about the non-invasive tests to screen for kidney disease," Brosius said. "Doctors should use this advi...

Study finds cardiac toxicity rates high with herceptin use

...A warning in 2003 that Herceptin use can result in congestive heart failure, leading to inability to pump enough blood throughout the body, or dysfunction in the heart's ventricle chamber, which pumps blood out of the heart. According to Esteva, before this study, no one had looked at what happened to patients ...

Studies highlight need to monitor heart function in breast cancer patients

...of breath and fluid retention. One patient died of congestive heart failure. Women whose LVEF was lower than normal before therapy began were more likely to experience an impairment of heart function as a result of treatment. "Long-term use of Herceptin appears to be safe, but some patients will experience ca...

Imaging technique may prevent injury during ablation for atrial fibrillation

... been shown to increase significantly the risk for congestive heart failure and stroke. ...

Drazner to lead UT Southwestern heart failure and transplant program

...nine years, specializing in treating patients with congestive heart failure and caring for patients before and a...ncludes a range of adult heart diseases, including congestive heart failure, treatment prior to and following heart transplantation, and critical care cardiology....

Drug could prevent type 2 diabetes in high-risk individuals

...prevented, with an excess of four to five cases of congestive heart failure."...

Over 1.6 million Americans use CAM for insomnia or trouble sleeping

...ificant health conditions: diabetes, hypertension, congestive heart failure, anxiety and depression, and obesity...ed with four of the five conditions: hypertension, congestive heart failure, anxiety and depression, and obesity. Other key points reported in the analysis incl...

About 5 percent of adults with insomnia use alternative therapies

...64, and was associated with obesity, hypertension, congestive heart failure and anxiety or depression, but not diabetes. Of those with insomnia or trouble sleeping, 4.5 percent reported that they had used CAM to treat the condition, which is equal to about 1.62 million adults in the general population. Survey...

Depression, not antidepressants, increases mortality risks in heart failure

...eer Research Award. Heart failure, also known as congestive heart failure, is marked by the inability of the heart muscle to pump enough oxygen and nutrients in the blood to the body's tissues. Despite its name, not everyone dies immediately and many live for years. A variety of factors can cause heart fail...

November/December 2006 Annals of Family Medicine tip sheet

...hnic group, African-Americans, in the treatment of congestive heart failure. This analysis discusses background issues to help prepare physicians to counsel patients about this controversial drug.BiDil: Assessing a Race-Based Pharmaceutical By Howard Brody, M.D., Ph.D., et al...

1 2 3 4 5 6

(Date:6/18/2013)... for Molecular Pathology is proud to announce it will ... (FASEB) on July 1, 2013. The FASEB Board approved ... , The 26 constituent societies of FASEB represent more ... the advancement of research and education in biological and ... important now than ever," said Jennifer L. Hunt, MD, ...
(Date:6/18/2013)... of internationally recognized feline experts including veterinarians and feline ... of Lincoln, U.K. and Dr Ilona Rodan, Director of ... International Society of Feline Medicine (ISFM) and the American ... veterinarians, owners and those working with cats on how ... The new guidelines appear in the Journal of ...
(Date:6/17/2013)... have identified a new virus in patients with severe ... determine whether the virus is responsible for the symptoms ... total of 28 out of 644 patients with severe ... but not in any of the 122 patients with ... the brain and central nervous system are often fatal ...
Breaking Biology News(10 mins):Feline behavior experts release guidelines to improve the welfare of cats 2New virus isolated from patients with severe brain infections 2New virus isolated from patients with severe brain infections 3
Other Tags
primitivespecificdamagehavewilsonlocalizedantibacterialgalliumstandlegalflawedfatallysimilarpeersattractattitudes