Tag: "culture" at medical news

Findings advance use of adult stem cells for replacement bone

...rs at Rice University have discovered a new way to culture adult stem cells from bone marrow such that the cells themselves produce a growth matrix that is rich in important biochemical growth factors. The research, which appears online this week in the Proceedings of the National Academy of Sciences, is not...

New infectious agents pose new risks for people with bleeding disorders, Jefferson hematologist says

...enes for clotting factors in the laboratory tissue culture dish lessen the likelihood of contamination by infectious agents. "There will always be emerging pathogens and we won't always know what they are," says Dr. Siegel, who is director of the Hemophilia Center at Thomas Jefferson University Hospital. "W...

Neuronal receptor response may help explain Alzheimer's memory loss

...am found that adding APOE to neurons in laboratory culture blocked NMDA receptors. In this study, they confirmed through a series of experiments that the receptors for APOE and NMDA interacted, and that the protein that linked the two was PSD95, often found in neural synaptic junctions. Together, they form a...

The long research road to a new vaccine

...selves into new strains. By co-infecting cells in culture with the WC3 strain of rotavirus and five different human rotavirus strains known as G1, G2, G3, G4, and P1, the scientists were able to create a reassortant bovine-human rotavirus virus that promised improved protection against rotavirus disease. Sp...

Soaring UK rates of Chlamydia infection partly caused by more sensitive tests

...ication testing, or NAAT as it is known. Using the culture tests, just over 6 per cent of women and just over 7 per cent of men tested positive. But almost 10 per cent of women and just over 11 per cent of men tested positive, using NAAT. The increase equates to a 62 per cent jump in positive results for wom...

JCI table of contents, January 26, 2006

... inhibition of Crry in tubular epithelial cells in culture increased alternative pathwaymediated injury. The study, which appears online on January 26 in advance of print publication in the February 2006 issue of the Journal of Clinical Investigation, found that altered expression of Crry by the renal tubula...

BRCA1 gene found to inhibit two sex hormones, not just one

...one, progesterone. The findings, conducted in cell culture and in mice and reported by the researchers in the...ducted a series of experiments. In one set of cell culture studies in the laboratory, they used breast cancer cells that were responsive to progesterone, and t...

First baseline data by REACH supports and extends ESC's Euroaspire findings

... consequent avoidance of diabetes, together with a culture that avoids tobacco. Such an approach would inevi... burden of cardiovascular disease by encouraging a culture of physical activity, avoidance of overweight, and avoidance of tobacco, together with increased det...

An engineer, a dentist, a veterinarian build bone tissue

...ngineering Laboratories, and has six years of cell culture and tissue engineering experience with bone marrow stromal osteoprogenitor cells at Virginia Tech. Skrtic has studied ACP precipitation, purification, and incorporation into remineralizing resins for the past 12 years. Shires' primary research intere...

FSU study finds body image stereotypes may begin in the high chair

...oiner said. "They also have stereotypes about male culture that boys should be big and strong and physical." It's what Joiner believes is part of parents' increasing pursuit of perfect lives for their children. Parents want their children to have the right clothes, the right friends, the right activities and...

New evidence supports century-old theory of cancer spread

...Their behavior was astonishing," said Pawelek. "In culture dishes, fused cells were extraordinarily motile compared to unfused melanoma cells. They spread rapidly when implanted in mice. Even though the idea is virtually unknown to cancer researchers today, many scientists worked on it in the 20th century. F...

How the neuron sprouts its branches

... And importantly, said Ehlers, the studies in cell culture revealed that the Golgi orientation preceded the preferential growth of long dendrites. "This finding showed us that we weren't just seeing a correlation between Golgi and longer dendrites," said Ehlers. "Initially, when these growing dendrites are a...

Medical College of Wisconsin study

...racial/ethnic element having people from the same culture act as interpreters and advocates we found remarkable success in the program," Dr. Flores says. He believes the results show that case management could not only effectively reduce the number of uninsured children in a community, but also might serve...

Debilitating jaw and neck pain targeted through $19 million NIH support, multidisciplinary center

...she said. "We also used molecular biological, cell culture and animal behavior experiments to show a relationship between variations in the gene that makes COMT, COMT enzyme activity and pain sensitivity. This was the first demonstration that a genetic variation influences both human pain perception and the ...

Engineered blood vessels may be an option in cardiac bypass

...he vessel from clotting." The cells are fed in a culture dish with a proprietary media that encourages the ...id. "The sheet can then be detached from the cell culture substrate and rolled, stacked or molded into more complex three-dimensional organs, such as a blood ...

Backyard treatment may yield leukemia treatment

...plant. Early results on CML patient cells both in culture and in mice showed that forskolin reduced the cancer cells' ability to grow by up to 90 percent. "We believe these are significant findings," said Danilo Perrotti, a member of the OSU Comprehensive Cancer Center 's Molecular Biology and Cancer Genet...

Multilateral initiative on malaria seeks international effort

... investment that allows us to establish a research culture focused on malaria, one that begins attracting scientists at the undergraduate level," said Wen Kilama, Managing Trustee of the African Malaria Network Trust (AMANET), which is based in Dar es Salaam. "We also know that creating a sustainable malar...

Sexually satisfied but feeling frumpy: It's body image, not 'the change'

...dy image, have concluded that the emphasis in U.S. culture on being young and thin has a more important influence than menopause on sexual functioning and satisfaction. Dr. Patricia Barthalow Koch, associate professor of biobehavioral health and women's studies who led the study, says, "The success of Viag...

Lancet study: Pfizer's Vfend equals two-drug candidemia regimen, with fewer serious side effects

...d 370 patients who had at least one positive blood culture for Candida within 96 hours of entering the study,...d clinical signs and symptoms and a negative blood culture for Candida 12 weeks after each patient's treatment ended. In both treatment groups, 41 percent of p...

Sandia researchers determine that common anthrax sampling methods need improvement

.... Five hundred spores must exist before a positive culture is observed in both the wiping and vacuuming methods. The current EPA clean-up criterion is no positive cultures from environmental samples - meaning a site may be cleared because no samples were positive, but viable spores may still remain. The most...

1 2 3 4 5 6 7 8 9

(Date:5/16/2013)... -- Injectable nanoparticles developed at MIT may someday ... diabetes to constantly monitor their blood-sugar levels and ... designed to sense glucose levels in the body ... insulin, thereby replacing the function of pancreatic islet ... 1 diabetes. Ultimately, this type of system could ...
(Date:5/16/2013)... relationship between the heritable risk for schizophrenia and ... is commonly associated with cognitive impairments that may ... IQ may be linked to the risk for ... precede the onset of schizophrenia symptoms. Also, these ... people diagnosed with schizophrenia. , In a remarkable ...
(Date:5/16/2013)... May 16, 2013 Integrated Biometrics patented ... a custom thin film transistor camera introduces Sherlock, ... roll image in the smallest and lightest form ... Appendix F Mobile ID FAP 45, Certified scanner ... in size and weight when compared to optical ...
Breaking Biology News(10 mins):Nanotechnology could help fight diabetes 2Nanotechnology could help fight diabetes 3Genetic risk for schizophrenia is connected to reduced IQ 2
Other Tags
sarawakmalaysianweevilnicetrendupwardpredisposingemphasiscouricmovieadvisestraymitigatesolicitousnessgastroenteritisgatorade