Tag: "daily" at medical news

New treatment boosts muscle function in myasthenia gravis

... is expected to improve patient compliance because daily injections wont be needed. People with myastheni...study, 16 people with myasthenia gravis were given daily doses of oral EN101 antisense for four days and monitored for one month. Four of the people later t...

Study, meta-analysis examine factors associated with death from heatstroke

...found that being confined to bed, not leaving home daily or being unable to care for oneself also are assoc...did not. Being confined to bed, not leaving home daily and being unable to care for oneself were associated with the highest risk of death during heat wave...

News briefs from the journal Chest, August 2007

...intravenous diuretics. Patients were treated twice daily for 3 days, and polysomnography was used to assess apnea severity before and after diuretic treatment. After 3 days, researchers found significant improvement in sleep-disordered breathing and an increase in upper airway caliber. They also reported a...

New study counts the economic cost of persistent pain in Australia

...istent pain with substantial interference to their daily lives that can be so extreme that it can sometimes result in suicidal thoughts or actions, said Dr Bennett. Professor Cousins said there has been an explosion of knowledge about persistent pain and its treatment over the past 10 years, yet it remai...

Despite claims, not all probiotics can treat diarrhea say experts

...brand image and price. Duration of diarrhoea and daily number and consistency of stools were monitored as primary outcomes. Secondary outcomes were duration of vomiting and fever and rate of admission to hospital. Safety and tolerance were also recorded. Duration of diarrhoea was significantly lower in...

Diet foods for children may lead to obesity

...-balanced diets with sufficient calories for their daily activities rather than low-calorie snacks or meals...ow-calorie foods and drinks are given to them on a daily basis, and this subverts their bodies' energy-balance system. "Parents and health professionals sh...

Where's the beef? Not enough of it is on elders' plates, muscle-metabolism study suggests

... adults are eating less than the USDAs recommended daily allowance of protein. Elderly people may eat les...icient muscle is fundamental for the activities of daily living, movement and independence its definitely a quality-of-life issue. ...

Better mobility keeps seniors healthier

...urther deterioration that can interfere with other daily living activities. As the U.S. population ages, it becomes increasingly important to identify and target interventions for those people who are at risk for further disabilities and illness. In a paper published in the September issue of the American ...

Geriatric health conditions have major effect on half of all seniors

...fect their ability to participate in activities of daily living, such as bathing and dressing on their own.... the respondents had difficulty with activities of daily living (bathing, dressing, eating, toileting or transferring) and needed assistance to complete the ...

Controlling prescription drug expenditures: a case report of success

... quantities of select medications not intended for daily use. The health plans goal, according to the studys authors, was to control prescription drug spending while preserving high quality medical care. An advisory outpatient prescription drug committee, which included physicians and pharmacists, was fo...

It's time to look at health risks in a new light, authors say

...nd the air we breathe" How should we interpret the daily flood of news reports on sometimes contradictory medical studies" A new book, co-written by a Johns Hopkins University professor and an outside colleague, seeks to examine health questions like these in a new light. Authors Erik Rifkin and Edward B...

European heat waves double in length since 1880

The most accurate measures of European daily temperatures ever indicate that the length of heat...e new data shows that many previous assessments of daily summer temperature change underestimated heat wave events in western Europe by approximately 30 perc...

International symposium on fruit, vegetables headed for Houston

Fruits and vegetables tasty and a vital part of daily nutrition. But researchers worldwide continue to seek better ways to use the healthful properties of these foods. Many of these scientists will meet in Houston Oct. 9-13 to share the latest findings. FAV Health 2007 - Fruits And Vegetables, that is...

USC law professor battles schizophrenia

...nds knew of her condition which she controls with daily therapy and medication. I wanted to write this book to give hope to people who suffer from schizophrenia and understanding to people who dont, said Saks, an expert in the field of mental health law who also holds faculty appointments at the Keck...

Takeda responds to the FDA advisory committee recommendation

...cular disease, who were force titrated up to 45 mg daily of either ACTOS or placebo. In this study, there was no difference in the number of macrovascular events between standard of care and ACTOS, and standard of care alone. Although there was no statistically significant difference between ACTOS and st...

Landmark study finds adult Delawareans with disabilities in only 'fair' to 'poor' health

...type of physical activity, and most do not eat the daily amount of fruits and vegetables recommended by the Centers for Disease Control. Additionally, the respondents had a higher incidence of secondary health conditions, including high cholesterol (47 percent), high blood pressure (45 percent), arthriti...

Sucampo Pharmaceuticals submits supplemental new drug application for Lubiprostone to treat IBS-C

..., patients received lubiprostone 8 mcg taken twice daily (783 adults) or placebo (388 adults) over a 12-wee...rials, patients receiving lubiprostone 8 mcg twice daily were nearly twice as likely to achieve an overall response that was statistically significant compar...

Polish journalist scoops first prize in prestigious European award

...rder to raise awareness about the challenges faced daily by cancer patients: Eric Baumann of TagesAnzeiger, Switzerland and Iva Skochova from the Prague Post, Czech Republic. The journalists will be presented with their prizes at a ceremony that will take place during ESOs forthcoming media event Cancer:...

New mangosteen research establishes xanthone measurement standard

...ency. Preliminary results also showed long-term daily consumption of XanGo Juice to increase levels of xanthones in the blood. "This is an issue of quality over quantity, said Mike Pugh, manager, research and development at XanGo. These preliminary findings add further context to the published xanthone...

STAMP system can help professionals to identify potentially violent individuals

...nd social security staff are an increasing part of daily life says Luck. We feel that the STAMP system provides an easy to remember checklist that can be used in a wide range of potentially stressful situations to provide an initial indication of possible violence. Recognising the early signs that can...

1 2 3 4 5 6 7 8 9 10

(Date:4/17/2014)... hundred births, Down syndrome - or trisomy 21 - ... It results from a chromosomal abnormality where cells of ... (1% of the human genome). A study conducted by ... Genetic Medicine and Development at the University of Geneva ... shed light on how the extra chromosome 21 upsets ...
(Date:4/17/2014)... Clemson professor Rajendra Singh Thursday as a "Champion ... expand solar deployment in the residential, commercial and ... Professor of Electrical and Computer Engineering and director ... a local hero leading the charge across the ... solar power and driving policy changes at the ...
(Date:4/17/2014)... such as heart disease, epilepsy and pain, making them ... is still much scientists do not know about the ... into the structure of sodium channels and, specifically, one ... responsible for ,fine-tuning, the activity of the channel. The ... the Journal of Biological Chemistry . , Nerves ...
Breaking Biology News(10 mins):Trisomy 21: How an extra little chromosome throws the entire genome off balance 2Trisomy 21: How an extra little chromosome throws the entire genome off balance 3White House honors Clemson professor as 'Champion of Change' for solar deployment 2Structure of sodium channels different than previously believed 2
Other Tags
architectsbeaverrunawaycaspaseclindamycinplentifulpertussisimmunogenicityallergenillnessessupplementsherbalprofessorshipbassetspaceddocument