Tag: "deciphered" at medical news

Researchers discover gene crucial for nerve cell insulation

... in peripheral neuropathy. "The researchers have deciphered a key sequence essential to the assembly of myelin," said Duane Alexander, M.D., Director of the NICHD, the NIH institute that funded the study. "Their discovery will provide important insight into the origins of disorders affecting myelin productio...

Academic medical centers face multiple challenges for conducting medical research

...esearch than ever before. Contemporary science has deciphered the human genome, discovered some of the potential of stem cells, and unleashed the power of information technologies. Any one of these three historic scientific achievements would have the potential to effect a fundamental transformation in medicine...

1

(Date:11/12/2014)... 12, 2014 Crossmatch™, a leading provider of ... ® fingerprint readers have been deployed throughout Montparnasse ... Central Mexico . The bakery chain implemented the ... issues caused by employees clocking in for each other. ... readers, Montparnasse relied on paper timecards and a mechanical ...
(Date:11/7/2014)... Dr. Debra Auguste, associate professor, biomedical engineering, in ... College of New York, have identified a molecule ... of the most aggressive forms of breast cancer. ... high mortality rate owing to aggressive proliferation and ... However, Professor Auguste,s team, discovered the overexpression of ...
(Date:11/6/2014)... groundbreaking paper from a team of Florida State University ... plants could adapt to and survive environmental swings such ... the latest issue of the journal The Plant ... of DNA and proteins) is organized in a cell ... genes are turned on and others are turned off. ...
Breaking Biology News(10 mins):Montparnasse Pasteleria Achieves Time and Attendance Transparency with Crossmatch U.are.U Fingerprint Readers 2Maize analysis yields whole new world of genetic science 2
Other Tags
bloomduecorpsesmellyvalvesimplifyarisingschrenkinsurancecirrhosiscelecoxibtooculpritfindresearchersstanford