Tag: "diagnosed" at medical news

Conventional prognostic factors fail to explain better prostate cancer survival in most Asian men

... U.S. in 2007, over 218,000 men are expected to be diagnosed with prostate cancer and over 27,000 will die. Es...no, Japanese, Korean, South Asian, and Vietnamese) diagnosed with prostate cancer. Dr. Robbins and his coauthors found that for each Asian ethnic subgroup, pro...

Survival differences by race most apparent in advanced stages of breast cancer

...cancer (21,861 African American and 234,313 white) diagnosed from 1988-2003 showed that African American women were more likely than white women to be diagnosed with tumors greater than 2.0-cm and to have at least one lymph node with disease. However, racial di...

RAND finds cases of undiagnosed diabetes drop sharply

...n males are now less likely to have their diabetes diagnosed than those men with more schooling. If we only t...t during the period studied, the proportion of men diagnosed with diabetes jumped from about 3 percent to 7 percent -- a more than doubling of the prevalence rat...

Study says COPD testing is not measuring up

... Assurance, Dr. Han identified patients with newly diagnosed COPD by data collected from five health plans. The study examined patients aged 40 years and older, and determined if patients with a new diagnosis of COPD had received spirometry in the preceeding 720 days. Of the 5,039 eligible patients identified...

Stomach cancer rate set to fall further 25 percent over next decade

...of the cases were intestinal metaplasia, which was diagnosed in almost 66,000 patients during the monitoring pe...omen and men, respectively. Dysplasia, which was diagnosed in just over 8500 patients, and atrophic gastritis, which was diagnosed in just over 23,000, both fe...

Seat belt injuries could signal more serious trauma in children

...l injuries. If spinal-cord injury is missed or not diagnosed early, the consequences can be devastating, said Harsh Grewal, M.D., in a report published in August issue of the Journal of Spinal Cord Medicine. Grewal, a pediatric surgeon at Temple University School of Medicine and Hospital, and his colleagues r...

Using MRI for diagnosis could help prevent breast cancer progression

... women who had a diagnosis of DCIS, 153 (92%) were diagnosed by MRI compared with 93 (56%) diagnosed by mammography. Whereas the sensitivity of MRI for diagnosing DCIS increased with nuclear grade, tha...

Stem cell transplantation procedure results in long-term survival for amyloidosis patients

...tion can result in long-term survival for patients diagnosed with primary systemic light chain (AL) Amyloidosis. The findings appear prepublished in the First Edition of Blood and can be viewed on Blood Online at http://www.bloodjournal.org/papbyrecent.shtml . BUMC was the first to begin using this treatm...

Shining light on pancreatic cancer

...hers scanned tissue samples from 19 people already diagnosed with pancreatic cancer and 32 without the disease....ted, with 100 percent accuracy, polyps in patients diagnosed with a simultaneous colonoscopy. Because the experimental procedure only scans the outer few centi...

New grant fulfills wish of late Baltimore Orioles team photographer

...o 91 percent for melanoma. The number of Americans diagnosed with MCC has grown rapidly in the past 15 years to about 1,400 cases per year, a number that is expected to grow in the future. MCC usually appears as a firm, painless lump on sun-exposed areas of the body. The lump is usually less than 2 cm (about...

Investigating the causes of Parkinson's disease

...0 people in the UK have Parkinsons, and 10,000 are diagnosed with the condition every year. Although more commo...n in people aged over 60, about one in 20 of those diagnosed each year are under 40. Dr Breen added: The Parkinsons Disease Society is very pleased to be fundi...

Cancer research summaries

...o had received donated blood from a person who was diagnosed with cancer less than 5 years after giving blood. ... health registers and donors who were subsequently diagnosed with a malignancy within 5 years of the blood donation were deemed to harbour a sub-clinical maligna...

Nonsmall cell lung cancer -- chemotherapy before surgery appears better than surgery alone

...d more than a million new cases of lung cancer are diagnosed each year, around 80% of which are non-small cell lung cancer. In addition, many patients are only diagnosed after the disease has progressed, so survival rates across all stages of disease tend to be fairly l...

Sucampo Pharmaceuticals submits supplemental new drug application for Lubiprostone to treat IBS-C

... and efficacy extension trial involving 522 adults diagnosed with IBS-C. In the two Phase III studies, patients received lubiprostone 8 mcg taken twice daily (783 adults) or placebo (388 adults) over a 12-week period. In both trials, patients receiving lubiprostone 8 mcg twice daily were nearly twice as like...

Wesley Research Institute study targets pharmacists to help diabetes sufferers

... problems. With around 600 new cases of diabetes diagnosed every week in Australia, it is imperative that we continue to look for better, more user friendly ways of managing this condition, he said. A major problem in Type 2 Diabetes management is the lack of understanding of how lifestyle influences day t...

UT study reveals inaccuracies in cardiac PET-CT imaging, finds fixes

...r patients who have recently had a PET-CT and been diagnosed with coronary artery disease, Gould recommends they seek a second opinion and request review of their PET-CT scans for these errors in matching the PET and CT images. Alternatively, traditional or pure PET without the CT component is less subject ...

Intensive-care patients with alcohol problems are more likely to require mechanical ventilation

...ore specifically, of the 785,602 patients who were diagnosed with one of the six medical diagnoses examined, 65,071 (8.3%) required mechanical ventilation. Those with an AUD (26,577) appeared to have an increased risk of requiring mechanical ventilation, while those who developed alcohol withdrawal (3,967) ap...

Hormone therapy offers new hope for ovarian cancer patients

...fecting 1 in 48 women. Nearly 7,000 new cases are diagnosed in the UK each year. Current treatment involves surgery and chemotherapy, but most ovarian cancers return within two years. Until now, further treatment options have been limited to a second course of chemotherapy, with serious implications for qu...

How to market diet pills: Prescription and over-the-counter pills may increase unhealthy behavior

... behaviors such as exercise. When consumers are diagnosed with a health condition such as obesity, they dont immediately trade fries for carrot sticks or start taking brisk walks after dinner. In a forthcoming paper in the Journal of Consumer Research, Lisa Bolton and Americus Reed, both marketing professor...

Future therapies for stroke may block cell death

... neurological damage or even death if not promptly diagnosed and treated. It is the third-leading cause of death and the leading cause of adult disability in the United States. A great deal of research has gone into developing histone deacetylase inhibitors as novel therapeutics, but the majority of the work...

1 2 3 4 5 6 7 8 9 10

(Date:8/28/2014)... N.C. -- Scientists have identified the developmental on-off switch ... that produce more than two-thirds of the world,s naturally ... be to see whether it is possible to manipulate ... , The study, appearing August 28 in ... small molecule called cyclic-di-GMP and a larger protein called ...
(Date:8/28/2014)... examples of complex systems. Their infrastructure equipment requires ... cooling, transport to supply fuel, and ICT systems ... network chain is interconnected with a wider network ... of UK-based scientists has studied various aspects of ... been published in EPJ B by Gaihua Fu ...
(Date:8/28/2014)... Cars, planes and ... sophisticated assembly lines. Mobile assembly carriers, on to which the ... lines. In the case of a car body, the assembly ... precise spatial and chronological sequence, resulting in a complete vehicle ... such an assembly line at molecular level has been a ...
Breaking Biology News(10 mins):Small molecule acts as on-off switch for nature's antibiotic factory 2Small molecule acts as on-off switch for nature's antibiotic factory 3Inter-dependent networks stress test 2Nanoscale assembly line 2Nanoscale assembly line 3
Other Tags
speedycootsovulationperimenopausalpeeksgenesystemsstrepasidewallsbumpdegradationimmunitiesbrandedpolymerpurduesexes