Tag: "differential" at medical news

Health reform bills could improve quality and efficiency, but fall short of national plan

...population- or episode-based care and reducing the differential between high payment for procedures and relatively low payment for primary care services. Creation of an entity such as a National Quality Coordination Board, as recommended by the Institute of Medicine, to ensure that public and private efforts rei...

Smoking may interfere with alcoholics' neurocognitive recovery during abstinence

... psychiatry at the University of Florida. [These] differential outcomes demonstrate the importance of considering the behavioral impact of continued cigarette smoking among alcoholics on long-term recovery of function. Durazzo concurred. Previous research on neurobiological and cognitive recovery from chronic...

Award winning book co-edited by Rutgers College of Nursing Dean updated with new information

...nical case examples to demonstrate the pitfalls in differential diagnosis and explain proper management and treatment. The book includes appendices that provide critical reference information for each of the bacterial, viral, fungal, and parasitic diseases. This book provides readers the knowledge to better und...

Gender impacts colorectal cancer progression

...ifferences between men and women may contribute to differential tumor development and progression in colon cancer patients, a study led by researchers at the University of Southern California (USC) suggests. Taking gender into account when examining the genetic profile of patients may help to those who will be...

Article outlines current recommendations for treating malaria in the US

...ining a travel history, considering malaria in the differential diagnosis of fever based on the travel history, and prompt and accurate diagnosis and treatment. Chloroquine remains the treatment of choice for Plasmodium falciparum acquired in areas without chloroquine-resistant strains. In areas with chloroquine ...

Smoking influences Crohn's disease

...ther investigated, to understand why smoking has a differential effect on different parts of the bowel."...

Latest IPCC report highlights need for integrated climate/human behavior models

...aptation is a social process that is influenced by differential interests, values, preferences, priorities, resources and power. All of these factors may change in response to ongoing societal transformations, thus the capacity to adapt to climate change can be considered highly dynamic. The way that society adap...

Mayo Clinic study shows drug-eluting stent use in heart patients determined more by insurance type

... including age, gender and race that contribute to differential health care services. The authors say the findings are important because they identify an area ripe for policy interventions -- probably at the hospital level -- to assure that clinical, instead of nonclinical, factors drive therapy decisions. All ...

Conference honoring UH professor attracts researchers from United States, abroad

... Conference on Applied and Numerical PDEs (partial differential equations) March 9-10 to acknowledge the career achievements of Roland Glowinski, Hugh Roy and Lillie Cranz Cullen Professor of Mathematics. Glowinski, who also is a mechanical engineering professor, is an expert on numerical analysis and variational...

Improved adherence to certain medications associated with longer survival following heart attack

...analyses," the authors write. "In conclusion, the differential class effects of drug adherence on long-term survival following MI suggest that adherence-related mortality benefits associated with evidence-based pharmacotherapies are mediated by drug effects more so than by generic healthy adherer behavioral attr...

'GreeneChip' -- New diagnostic tool that rapidly and accurately identifies multiple pathogens

...neChip is the first tool to provide comprehensive, differential diagnosis of infectious diseases, including those caused by viruses, bacteria, fungi, or parasites. In addition, it is the first tool that can be used on a wide variety of samples, including tissue, blood, urine, and stool, allowing for the rapid id...

Sleep problems -- real and perceived -- get in the way of alcoholism recovery

...rking with the alcohol-dependent patient to have a differential of poor sleep quality in the back of their mind as a potential challenge for the patient throughout alcohol recovery."...

Recovering alcoholics with poor sleep perceptions will likely relapse

...rking with the alcohol-dependent patient to have a differential of poor sleep quality in the back of their mind as a potential challenge for the patient throughout alcohol recovery." Conroy and her colleagues will next examine the specifics of sleep problems among alcoholics. "Sleep across recovery from alcohol...

Mayo Clinic researchers find evidence for traumatic cause of carpal tunnel syndrome

...juries could be the result of marked or repetitive differential motion of adjacent digits, and may support the hypothesis of a traumatic cause for carpal tunnel syndrome," he says....

ACP's electronic medical resource ranked no. 1 evidence-based tool by MLA's South Central Chapter

...ns" are modules designed to help clinicians review differential diagnoses of symptoms and laboratory abnormalities....

Rare disease benefits from specialized clinic in Italy

...and colleagues outline a practical approach to the differential diagnosis of patients presenting with angioedema. In a related commentary, Bowen applauds the European approach to diagnosis and management of angioedema and encourages the development in Canada of patient data registries and national programs of co...

Mexican Americans have higher risk of stroke recurrence

...ces in physician treatment, patient compliance, or differential drug effectiveness by ethnicity could also translate into increased stroke recurrence for MAs," they note. They add that it would be useful to investigate the rate of other vascular events following stroke and that this should be explored in future s...

Digital surgery with touch feedback could improve medical training

...eal-time graphics, solving complex sets of partial differential equations about a thousand times a second, De said. The major challenge to current technologies is the simulation of soft biological tissues, according to De. Such tissues are heterogeneous and viscoelastic, meaning they exhibit characteristics of ...

Promoting seat belt use among black motorists

...acks about the possibility of racial profiling, or differential enforcement, whereby law enforcement officers coul...w violations. The authors note that "The issue of differential enforcement has received little attention in the peer-reviewed literature, and should be addressed u...

Daniel Zheng wins SIAM's first prize at INTEL-ISEF

...ariable calculus, linear algebra, and introductory differential geometry. He hopes to pursue a college major in computational biology or double major in mathematics and biology at MIT, Caltech or Brown. "Daniel is an extraordinary student, passionate about all areas of learning, although most especially about mat...

1 2 3

(Date:8/28/2014)... -- Scientists have identified the developmental on-off switch for ... produce more than two-thirds of the world,s naturally derived ... to see whether it is possible to manipulate this ... , The study, appearing August 28 in Cell ... molecule called cyclic-di-GMP and a larger protein called BldD ...
(Date:8/28/2014)... method for measuring and imaging how quickly blood flows ... understand how drug abuse affects the brain, which may ... lead to better treatment options for recovering drug addicts. ... from Stony Brook University in New York, USA and ... in The Optical Society,s (OSA) open-access journal ...
(Date:8/28/2014)... the first person to alert the world to Global ... be captured and stored underground. He says that Carbon ... the best way to avoid global warming getting out ... (Columbia University, New York) made the call during his ... where 150 scientists are meeting to discuss Carbon Capture ...
Breaking Biology News(10 mins):Small molecule acts as on-off switch for nature's antibiotic factory 2Small molecule acts as on-off switch for nature's antibiotic factory 3This is your brain's blood vessels on drugs 2This is your brain's blood vessels on drugs 3Global warming pioneer calls for CO2 to be taken from atmosphere and stored underground 2
Other Tags
speedycootsovulationperimenopausalpeeksgenesystemsstrepasidewallsbumpdegradationimmunitiesbrandedpolymerpurduesexes