Tag: "extensive" at medical news

Restless legs syndrome has complex genetic involvement

...nclude. "Furthermore, our findings illustrate that extensive characterization of subclinical differences represents a major tool in the identification of susceptibility loci for complex diseases Although the background of RLS is most likely complex, this finding may offer a new starting point for further diss...

Few women at risk for breast cancer willing to use drug to prevent the disease

...omen are unwilling to consider tamoxifen even with extensive education about its potential benefits and harms."...

Probable cause sequences for WTC collapses finalized

...apse then ensued. The sequences are supported by extensive computer modeling and the evidence held by NIST, including photographs and videos, recovered steel, eyewitness accounts and emergency communication records. Additionally, this information was used to document a variety of factors affecting the perfor...

'Nanoshells' simultaneously detect and destroy cancerous cells

...rezek says. Of course, any new technology requires extensive safety assessment before coming to market, but initial results from nanoshells testing are promising. Nanoshells developed for therapeutic applications have already been evaluated by Nanospectra Biosciences Inc., the Houston-based company that is com...

University of Chicago receives grant to study connections between religious beliefs and health

...ago and the suburbs. The researchers are gathering extensive medical histories, health assessments, health care utilization measures, health behaviors measures, sleep quality indices, personality measures and life events assessments. The Templeton grant will permit researchers to do these additional research ...

Stanford gut check shows diversity of intestinal ecosystem

...seases and geographic medicine, conducted the most extensive study to date surveying the inhabitants of the lower digestive tract. In the three healthy subjects he studied, he found 395 unique bacterial species. "The intestinal flora is critical to human physiology and a wide spectrum of disease, but the first...

Long term outcomes for children who undergo ear tube placement surgery

...bnormal outcomes and on whether they required more extensive ear surgery. The hearing level of healed ears was comparable to that of age-matched normal ears. "Ear surgery, which sometimes becomes necessary, is not hazardous for hearing, as such, but in the case of chronic middle ear infection may be insufficie...

Kidney donation program may provide more matches for previously incompatible recipients and donors

...concerns that a national KPD program would require extensive travel to accommodate matches, the study shows how optimization would dramatically reduce the number of pairs required to travel (2.9 percent vs. 18.4 percent). "Even if only 7 percent of patients awaiting kidney transplantation participated in an op...

Louder neurons form more connections, Stanford research shows

...hough the poorly-firing green neurons still formed extensive branching structures, which the researchers call the neuron's arbor, most of those branches eventually receded while neighboring neurons formed a large number of stable connections. When the fish were five days old, the green neurons had a smaller, l...

'Fickle' enzyme helps protect, but also can promote heart failure, animal study shows

...that control the enzymes' action. Nitric oxide's extensive portfolio of natural effects includes the ability to expand coronary arteries, which improves blood flow, and to help regulate the strength of the heart's contraction, notes cardiologist David Kass, M.D., a specialist in enlarged hearts, or hypertrop...

Prevalence of concussion effects linked to 'pot of gold' lawsuits, researcher says

... injury cases involved probable malingering and or extensive symptom exaggeration. Carlton Carl, spokesperson for the Association of Trial Lawyers of America, disputes the conclusion. "Only the most serious injuries caused by the negligence of others tend to be litigated, and there are -- and should be -- seri...

Excess oxygen worsens lung inflammation in mice

...cent oxygen for 48 hours. These mice suffered very extensive lung damage, and 11 of 15 died. Finally, the scientists treated another 15 mice with acute lung inflammation with a combination of 100 percent oxygen and an adenosine-like drug to compensate for the oxygen-induced loss of natural adenosine. Only two ...

Autism conference reports advances in early diagnosis, role of immune system and more

...initiated the annual conference, which is the most extensive exploration of research advances in autism. Early Detection Scientists reported progress in being able to diagnose the youngest children through both biomarkers and behavioral observations. "Whereas today most autistic children are not diagnosed...

Breast CT reaches clinical testing: May improve on mammography

...rlier than mammography. Boone believes that a more extensive trial could be under way within two to three years. Boone developed the machine in collaboration with UC Davis radiology professors Karen K. Lindfors and J. Anthony Seibert, and UC San Diego radiology professor Thomas R. Nelson. The breast CT project...

Study finds maternal exposure to parasitic infection may increase risk of schizophrenia in offspring

...oring blood sera samples, the CHDS study collected extensive data on the prenatal period, and conducted maternal interviews on family health history, maternal and paternal health habits, and maternal and paternal socio-demographic information. In 1997- 1999, the research team used electronic databases to iden...

Researchers prevent post-traumatic brain damage

...rch team have taken was suggested by findings from extensive gene studies conducted at Georgetown. Rather than trying to stop the earliest damage that results from the direct mechanical injury--the approach that is now most often used clinically--the Georgetown researchers took the tactic of trying to limit a...

Study shows grapefruit extract can heal stomach ulcers

...ale counterparts and, as a result, may suffer more extensive liver disease if they drink the same amount as a man. In this study, researchers at the University of Pittsburgh School of Medicine and the Veterans Affairs Medical Center used animal models to analyze the differences in liver injury between the sexe...

ESC releases new chronic heart failure guidelines

..."These Guidelines also recognise the impact of the extensive co-morbidity in this population, the importance of the large geriatric population and the special needs of patients with advanced Heart Failure". Guidelines Formats The ESC Chronic Heart Failure Guidelines are available in a variety of formats (Ful...

ESMO Minimum Clinical Recommendations

...tries of Europe. They are not designed to replace extensive clinical practice guidelines or review articles, but to describe minimum common standards. Considering the rapid changes in the field of medical oncology, each guideline undergoes a yearly update. "The Minimum Clinical Guidelines are an important ex...

Men with spouses, partners, fare better after prostate cancer treatment

...e is important because the quantity of life can be extensive for these patients," Gore said. "We want quality of life to be as good as possible." Litwin, Gore and the research team focused on a severely disadvantaged group of prostate cancer patients in the study low-income and uninsured or underinsured men e...

1 2 3 4 5 6 7 8 9 10

(Date:11/21/2014)... , Nov. 20, 2014   Atmel® Corporation ... microcontroller (MCU) and touch technology solutions, today launched the ... with the widest V cc range from ... accuracy and faster I 2 C bus communication speeds, ... EEPROM memory making them ideal for consumer, industrial, computer, ...
(Date:11/18/2014)... BETHESDA, Md. , Nov. 17, 2014 The ... European and U.S. regulatory agencies will speak and at least ... Quality Metrics Conference at the Omni Shoreham Hotel in ... is pleased once again to have significant support from the ... and Europe in our effort to ...
(Date:11/12/2014)... Nov. 12, 2014 Crossmatch™, a leading provider ... U.are.U ® fingerprint readers have been deployed throughout ... Central Mexico . The bakery chain implemented ... payroll issues caused by employees clocking in for each ... fingerprint readers, Montparnasse relied on paper timecards and a ...
Breaking Biology News(10 mins):Atmel Launches Industry's First Wide-V(cc) Low-Power Temperature Sensor Family 2Atmel Launches Industry's First Wide-V(cc) Low-Power Temperature Sensor Family 3Atmel Launches Industry's First Wide-V(cc) Low-Power Temperature Sensor Family 4FDA's Janet Woodcock, EMA's Emer Cooke Headline PDA Quality Metrics Conference 2Montparnasse Pasteleria Achieves Time and Attendance Transparency with Crossmatch U.are.U Fingerprint Readers 2
Other Tags
interfacebalancelonglinecasualtiesadversarycommerciallymirrorcletarcevashuntsalertssilenceamplifymetalsthinksvolunteersfully