Tag: "facing" at medical news

New oxidation methods streamline synthesis of important compounds

One of the fundamental challenges facing organic synthesis in the 21st century is the need to significantly increase the efficiency with which carbon frameworks can be constructed and functionalized. Chemists at the University of Illinois are helping to meet this challenge by developing a c...

New book guides boomers through retirement maze

... the often overwhelming legal and financial issues facing new retirees. UA Professor of Law Kenney Hegland...ilable that cover the entire range of legal issues facing baby boomers, including retirement income, housing, health care, estate planning, elder abuse, livin...

Cancer on the agenda of the Portuguese EU Council Presidency

...l issues in terms of the EU health agenda, such as facing specific health problems, health determinants, health services and patient mobility. The selection of such topics reflects the importance politicians place on assuring best quality healthcare, a service that touches the lives of every single EU ci...

Advocates ask fashion industry to support braille clothing tags; talking Web site

...l day of awareness in the United States for issues facing the blind. The day is named for the familiar white cane used by millions of people. If White Cane Day is the only single day that exists for them, then White Cane Label is pretty obvious, says Brill, who graduated in May from RIT with a bachelors...

Pancreatic surgery riskier for obese patients

...x (BMI) is one of the most important health issues facing health care professionals today, Dr. Berger noted. Higher BMI can lead to a greater risk of a patient developing diabetes and heart disease, as well as esophageal and pancreatic cancers. Increased BMI has been demonstrated to be an important factor...

E/Tablet technology may provide benefits to patients, researchers

..."The focused prompts are designed to help patients facing life-and-death issues to also remember important quality-of-life concerns they have had, such as how food taste might be altered by treatment, or whether they bruise more easily or have trouble sleeping." The researchers also speculate that the E/T...

Leading prevention researchers meeting in Washington, D.C., May 30-June 1, 2007

...ew findings on a wide variety of health challenges facing youth and families. More than 250 researchers will present the latest findings of their work, addressing a range of topics, such as: The tragedy at Virginia Tech has focused attention on what schools, families and students can do to prevent sim...

Violent sleep disorder linked to a form of dementia

...ion for many with Lewy body dementia. The quandary facing physicians is whether to inform patients that they have an increased risk of developing dementia or parkinsonism, when symptoms may not appear for years or may never appear at all. "Its an ethical dilemma," says Dr. Boeve. "We know that many patien...

Smoking, growing private hospital care for poor and US flu vaccine policies

...e likely to report better health status than those facing no smoking bans at work or home, according to first-of-its-kind study, which surveyed 1,472 Chinese American adults living in New York City. Even those with just a smoking ban at home fared better and were 1.90 times more likely to report better hea...

Quick, innovative procedure helps men minimize incontinence after prostatectomy

NEW YORK (May 11, 2007) -- Thousands of men facing surgical removal of the prostate due to cancer may someday have one less thing to worry about: post-surgical urinary incontinence. That's because a team of expert urologic surgeons at NewYork-Presbyterian Hospital/Weill Cornell Medical Center has d...

Use of Swedish 'snus' is linked to a doubled risk of pancreatic cancer

...upper lip to also smoke cigarettes, the challenge facing epidemiological research into snus and cancer has been to isolate the effects of the different kinds of tobacco. What makes this new study unique is that it has been possible to study the correlation between snus and cancer risk in a large enough gro...

UW study tests topical honey as a treatment for diabetic ulcers

...ney therapy a few years ago with a patient who was facing amputation after all medical options had been exhausted. Experts believe that treating wounds with honey has tremendous potential for the approximately 200 million people in the world with diabetes, 15 percent of whom will develop an ulcer, usuall...

ISHLT membership explores expansion of computer modeling system for organ allocation

...nd the ethical issues surrounding organ allocation facing patients awaiting transplants. Both will be discussed at its 27th Annual Meeting and Scientific Sessions, today in Satellite Symposium 9, Continued Evaluation of Heart and Lung Allocation Using Evidence Based Research. Worldwide, patients in need ...

Bypassing eggs, flu vaccine grown in insect cells shows promise

...m the egg brings implications important to a world facing the threat of pandemic bird flu. For decades the nations efforts to prevent flu have centered on growing flu virus in hundreds of millions of fertilized eggs, with each egg containing less than a teaspoonful of material that will ultimately become ...

Eye diseases gave great painters different vision of their work, Stanford ophthalmologist says

...all reached their heights of artistic vision while facing a decline in their ocular vision. Marmor chose to focus on Degas and Monet for these simulations because both artists suffered from eye disease that was well-documented in historical records, journals and medical histories. Degas had retinal eye dise...

Latest IPCC report highlights need for integrated climate/human behavior models

... by the IPCC WG2 show that in many cases the areas facing the largest changes in climate are not only located in countries that have contributed the least to the atmospheric buildup of greenhouse gases, but also those that have the least ability to adapt to them. "One way or another, we will adapt to a cha...

Healthy schools project gets an 'A'

ANN ARBOR, Mich. -- America is facing an epidemic. Despite numerous studies showing the negative effects of obesity on everything from heart disease and diabetes to possible links with cancer, one in five American children is obese. However, a collaborative program sponsored by the Unive...

Still some way to go in tackling racism in mental health care

...cted on, the Department of Health might not now be facing a formal investigation by the Commission for Racial Equality," they conclude....

Health insurance fails to protect Americans from financial risk

...late faster than wages and inflation, the question facing policy makers is how to make insurance affordable. "Health plans that keep premiums down by instituting high deductibles and scaled-back coverage don't address the underlying problem of rising costs. Instead, these plans shift costs onto consumers,...

First greenhouse gas animations produced using Envisat SCIAMACHY data

... change being the greatest environmental challenge facing the world today, numerous studies and results on greenhouse gases will be presented at the 2007 Envisat Symposium in Montreux, Switzerland, from 23 to 27 April....

1 2 3 4 5 6 7 8 9

(Date:5/17/2013)... Shenzhen, China---- Why Tibetan antelope can live at ... a collaborative research published in Nature Communications ... institutes provide evidence that some genetic factors may ... highland environments. The data in this work will ... and the biology of other ruminant species. , ...
(Date:5/17/2013)... team of scientists using a new X-ray method recorded ... frog embryo in greater detail than ever before., This ... and the search for new treatments for genetic diseases., ... Technologie in Germany, in collaboration with the Advanced Photon ... Laboratory, released the most precise depiction ever of the ...
(Date:5/16/2013)... fast food restaurant had a higher body mass index ... food, according to researchers at The University of Texas ... strong among those with a lower income. , ... Journal of Public Health indicates higher BMI associates ... among lower-income African-Americans, the density, or number, of fast ...
Breaking Biology News(10 mins):The genome sequence of Tibetan antelope sheds new light on high-altitude adaptation 2New X-ray method shows how frog embryos could help thwart disease 2Body mass index of low income African-Americans linked to proximity of fast food restaurants 2Body mass index of low income African-Americans linked to proximity of fast food restaurants 3
Other Tags
naturetoldentrepreneursrepellentsfiringmixesriboswitchespeekscryingnighttimechronicinfantsmaasiowacabonathan