Tag: "herpesvirus" at medical news

Landmark discovery of a Kaposi's sarcoma-associated herpesvirus receptor

...molecule involved in infection by Kaposi's sarcoma herpesvirus (KSHV), the virus that causes Kaposi's sarcoma and...g the mechanisms of cell entry of Kaposi's sarcoma herpesvirus is a landmark achievement in and of itself," says NIAID director Anthony S. Fauci, M.D. "But the con...

JCI table of contents, April 6, 2006

... involved in virally-induced Kaposi sarcoma Human herpesvirus 8 (HH8), also called Kaposi sarcoma herpesvirus, c... blood vessels and tumors in KS. TITLE: The human herpesvirus 8 chemokine receptor vGPCR triggers autonomous proliferation of endothelial cells AUTHOR CONTACT: ...

The Burroughs Wellcome Fund awards $8 million to infectious disease investigators

... of cellular gene expression by an oncogenic human herpesvirus Karen J. Guillemin, Ph.D. University of Oregon Regulation of gut epithelial cell homeostasis by the microbiota Lora V. Hooper, Ph.D. University of Texas Southwestern Medical Center-Dallas Innate immune responses to commensal bacteria at gut epith...

1

(Date:4/18/2014)... wildlife while feeding a world population predicted to ... holistic approach to conservation that considers human-altered landscapes ... Wildlife and the natural habitat that supports it ... world where at least three-quarters of the land ... rest is vulnerable to human-caused impacts such as ...
(Date:4/18/2014)... Seeds that sprout as soon as they,re planted may ... to be more careful. In the wild, a plant whose ... would risk disaster. More than just an insurance policy against ... seed dormancy has long-term advantages too: Plants whose seeds ... to more species, finds in a team of researchers working ...
(Date:4/17/2014)... COLUMBIA, Mo. April 17 In the most densely ... States, forests reflect two centuries of human needs, values ... logging and clearing forests for agriculture and development, have ... today, a U.S. Forest Service study reports. , The ... forest conditions and management needs in the Northern United ...
Breaking Biology News(10 mins):Stanford researchers rethink 'natural' habitat for wildlife 2Stanford researchers rethink 'natural' habitat for wildlife 3Stanford researchers rethink 'natural' habitat for wildlife 4Plants with dormant seeds give rise to more species 2Five anthropogenic factors that will radically alter northern forests in 50 years 2Five anthropogenic factors that will radically alter northern forests in 50 years 3
Other Tags
greatlyrumorsintegrityoctopussecretsbacteriumanthraxpotentialscreendefencesevadeshieldlovedincapacitatedwishespacemaker