Tag: "herpesvirus" at medical news

Landmark discovery of a Kaposi's sarcoma-associated herpesvirus receptor

...molecule involved in infection by Kaposi's sarcoma herpesvirus (KSHV), the virus that causes Kaposi's sarcoma and...g the mechanisms of cell entry of Kaposi's sarcoma herpesvirus is a landmark achievement in and of itself," says NIAID director Anthony S. Fauci, M.D. "But the con...

JCI table of contents, April 6, 2006

... involved in virally-induced Kaposi sarcoma Human herpesvirus 8 (HH8), also called Kaposi sarcoma herpesvirus, c... blood vessels and tumors in KS. TITLE: The human herpesvirus 8 chemokine receptor vGPCR triggers autonomous proliferation of endothelial cells AUTHOR CONTACT: ...

The Burroughs Wellcome Fund awards $8 million to infectious disease investigators

... of cellular gene expression by an oncogenic human herpesvirus Karen J. Guillemin, Ph.D. University of Oregon Regulation of gut epithelial cell homeostasis by the microbiota Lora V. Hooper, Ph.D. University of Texas Southwestern Medical Center-Dallas Innate immune responses to commensal bacteria at gut epith...

1

(Date:8/28/2014)... -- Scientists have identified the developmental on-off switch for ... produce more than two-thirds of the world,s naturally derived ... to see whether it is possible to manipulate this ... , The study, appearing August 28 in Cell ... molecule called cyclic-di-GMP and a larger protein called BldD ...
(Date:8/28/2014)... method for measuring and imaging how quickly blood flows ... understand how drug abuse affects the brain, which may ... lead to better treatment options for recovering drug addicts. ... from Stony Brook University in New York, USA and ... in The Optical Society,s (OSA) open-access journal ...
(Date:8/28/2014)... the first person to alert the world to Global ... be captured and stored underground. He says that Carbon ... the best way to avoid global warming getting out ... (Columbia University, New York) made the call during his ... where 150 scientists are meeting to discuss Carbon Capture ...
Breaking Biology News(10 mins):Small molecule acts as on-off switch for nature's antibiotic factory 2Small molecule acts as on-off switch for nature's antibiotic factory 3This is your brain's blood vessels on drugs 2This is your brain's blood vessels on drugs 3Global warming pioneer calls for CO2 to be taken from atmosphere and stored underground 2
Other Tags
speedycootsovulationperimenopausalpeeksgenesystemsstrepasidewallsbumpdegradationimmunitiesbrandedpolymerpurduesexes