Tag: "impact" at medical news

Good friends, rather than close family ties, help you live longer in older age

...ntervals. The research team also considered the impact of factors likely to influence survival rates, suc...ose contact with children and relatives had little impact on survival rates over the 10 years. But a strong network of friends and confidants significantly im...

Arthritis of the spine often overlooked in children

...hood. The findings, generated from a national life impact study and reported in the June 15 issue of Arthrit...isease-related disability later in life." The life impact study was commissioned by the Spondylitis Association of America and involved more than 2,000 ankylo...

Placebos can bring emotional relief

...ound that they can affect emotion, alleviating the impact of unpleasant experiences. In an article in the June 16, 2005, issue of Neuron, researchers led by Predrag Petrovic of the Karolinska Institutet show that, in relieving anxiety, placebo treatment affects the same basic modulatory circuitry in the bra...

'Binge drinkers': Folk devils of the binge economy

...a attention focuses on alcohol consumption and its impact on public order and health. But as Professor Dick ... as a criminogenic zone that was having a negative impact on their own crime and social order targets, official discussion has focused on the problematic cons...

Only transplant center that developed comprehensive protocol for liver transplants in kids with MSUD

...e Medicine. "Suffering from MSUD may significantly impact the quality of life for both the child and the parents. These parents live each day with the fear that a simple cold could send their child into metabolic crisis and be fatal." Jakob's amino acid levels now are normal, despite a normal protein intak...

Seven deadly sins: A new look at society through an old lens

...a attention focuses on alcohol consumption and its impact on public order and health. But as Professor Dick Hobbs shows, while 'binge drinking' youths dominate the headlines, it is older drinkers in their middle years that are most likely to succumb to alcohol-related death. He argues that it is the logic o...

Bipolar disorder more prevalent and costly than believed; Lithium could curb suicide rate

...rder, bipolar disorder has a significantly greater impact on an individual's ability to go to work or be pro...le in terms of both the loss of human life and its impact on society. Of particular concern is that attempts made by bipolar patients have about a one-in-five...

New study showed ramelteon helped adults with chronic insomnia fall asleep, sleep longer

...'s-Roosevelt Hospital, New York, NY. "Despite this impact on productivity, many are hesitant to seek treatment." These results were not confined to this single study. In other studies presented at the APSS meeting this week, ramelteon also helped older adults with chronic insomnia fall asleep faster and sl...

Pregnant women at risk for injury in summer

...rsity of Toronto. "Everyday lifestyle has a larger impact on the individual's safety." The study looked at all pregnant trauma patients admitted to Canadian hospitals between April 1, 1994 through March 31, 2001. During the seven years 2,618 pregnant women were admitted for major trauma, amounting to about ...

Assuring the supply of vaccines

...benefits and costs, including consideration of the impact of the price of a vaccine on recommendations for its use, there were widespread and varied responses. Editorials in the Wall Street Journal and the New York Times helped raise awareness of the complexities surrounding the vaccine industry. A briefing...

Endocarditis infection commonly related to health care factors, increasingly due to staph

...IE existed before now, the global significance and impact of regional variations on the characteristics, treatment, and outcome of S aureus IE has not been known. Vance G. Fowler, Jr., M.D., M.H.S., of Duke University Medical Center, Durham, N.C., and colleagues conducted a study to document the characteris...

Researchers improve lung cancer survival rates

... England Journal of Medicine, is already making an impact around the world. "With the very significant benef...hip in this important area will have a significant impact on the lives of people with lung cancer in Canada and around the world. We're delighted to have been...

Cancer researcher Susan Horwitz wins Alpert prize for Taxol work

... made major contributions to helping patients. The impact of Susan's work has been quite extraordinary in the cancer field," said Professor Dominick Purpura, MD, Dean of Albert Einstein College of Medicine, who nominated Dr. Horwitz for the prize. In fact, earlier this year, shortly after Dr. Horwitz was se...

Revealed: The true cost to the nation of multiple pregnancies

...ublic health and ethics, because costs can have an impact on whether a medical treatment is paid for by the ...e. "It is also very important to know the economic impact of our attitudes in order to take the most appropriate decisions, and to allow the greatest access t...

Rise in ICSI cycles suggests infertility could be affecting more men than women

...VF and ICSI. For the first time we are seeing the impact of patients and doctors choosing to implant only one embryo [elective single embryo transfer eSET], and in 70% of all transfers only one or two embryos were transferred. However, despite the reduction in the numbers of embryos transferred in one cy...

Study sheds light on the developmental origins of polycystic ovarian syndrome

...amines maternal factors during pregnancy and their impact on the subsequent development of PCOS, and is the first to reconcile previous conflicting research on the developmental origins of the syndrome. Dr Michael Davies, senior research fellow at the Research Centre in Reproductive Health at the University...

Gene testing doesn't increase anxiety, depression in children of people with Alzheimer's

... study focused on the psychological and behavioral impact of testing for the well-known risk marker for Alzh...ease) is the first randomized trial to examine the impact of providing risk assessment -- including APOE gene marker disclosure -- for Alzheimer's disease. T...

Look to the future: Preparing for baby boomer dementia epidemic

...symptoms of dementia in some people. The negative impact of unrecognized dementia on the management of other medical conditions is significant, noted Dr. Boustani. "Physicians typically are treating older adults for multiple chronic diseases such as hypertension, diabetes and high cholesterol and unless th...

Conflicts pitting doctors vs. patients / kin is #1 issue in medical ethics, Canadian experts say

...eath decisions for loved ones can have an enormous impact emotionally on family members charged with such responsibility. 10) Surgical innovation and new technologies Since variation is part of perfecting surgical techniques, it's difficult to determine when surgical innovation becomes a research exper...

$5.1 billion would save 6 million children

...pita. With the recent publication of the potential impact of proven interventions that are feasible to deliver in low-income settings to children younger than age 5 years, this is the first time the global cost of implementing child survival programs could be estimated. The study is published in the June 25...

1 2 3 4 5 6 7 8 9 10

(Date:6/17/2013)... 2013 An international team led by scientists at ... Institute and Albert Einstein College of Medicine of Yeshiva ... that attacks the tuberculosis (TB) bacterium in two different ... solve one of the major global health crises of ... strains," said Peter G. Schultz, the Scripps Family Chair ...
(Date:6/17/2013)... ST. LOUIS -- In research published in Biochemical ... describe a technology that can detect new, previously unknown ... for viruses even when doctors have not identified a ... , In the new approach, scientists use ... discover viruses. , Taking advantage of the complete deciphering ...
(Date:6/17/2013)... early onset of puberty in girls, a new clinical ... Endocrine Society,s 95th Annual Meeting in San Francisco. , ... 10 and 14. Boys undergo these changes later, usually ... is diagnosed in girls when sexual development begins before ... when these changes occur before age 9. , Recently, ...
Breaking Biology News(10 mins):New compound excels at killing persistent and drug-resistant tuberculosis 2New compound excels at killing persistent and drug-resistant tuberculosis 3New compound excels at killing persistent and drug-resistant tuberculosis 4Saint Louis University researchers discover a way to detect new viruses 2Saint Louis University researchers discover a way to detect new viruses 3Vitamin D supplementation may delay precocious puberty in girls 2
Other Tags
capillarymaterialisemisshapentacticsoupamchitkapassivelawnsstaraffirmsmelodyunbornregretbeverageassurefao