Tag: "indicates" at medical news

Advanced prostate cancer previously considered inoperable may be operable, curable

...uch as hormone therapy or radiotherapy. Dr. Zincke indicates that adjuvant therapy is necessary for patients whose prostate cancer affects the lymph nodes. Surgery alone may be sufficient treatment for those without lymph node involvement. Approximately 50 percent of the cases of cT3 prostate cancer do not inv...

Study finds radiation therapy for prostate cancer nearly doubles risk for rectal cancer

A University of Minnesota Cancer Center study indicates that men who undergo radiation therapy for prostate cancer have nearly double the risk of developing rectal cancer when compared to men who opt to have surgery to treat prostate cancer. The study found that men who receive radiation for prostate can...

Differential heart-attack risks among blacks, whites remain mystery

...lcium in either whites or African-Americans, which indicates that some other mechanism is at work." The Dallas Heart Study is a groundbreaking multiethnic investigation of cardiovascular disease involving thousands of Dallas County residents, and it contains the most representative sample of African-American s...

Institute of Medicine news: Review of HIVNET 012 study

...ting our own original analysis of source documents indicates a need to retract or discount the study's findings. Our confidence in the trial's data and findings is based on several factors, including evidence that the study's design was both scientifically sound and ethically implemented, that participants ad...

Delay in Alzheimer's disease onset seen for first time

...fects of the particular drugs tested, Dr. Petersen indicates he is enthusiastic about the underlying concept --...l mild cognitive impairment patients, Dr. Petersen indicates that the findings of this study open the door for discussion of donepezil treatment on an individual...

Anxious and pessimistic personalities linked to Parkinson's disease later in life

...e risk for Parkinson's disease; however, Dr. Bower indicates that this is an important question he and colleagues hope to address in the future. Dr. Bower and colleagues conducted this study to determine what types of personality or cognitive style -- one's habitual way of perceiving, remembering, behaving an...

Ovary removal elevates risk for Parkinson's disease and parkinsonism

...o injecting the toxic substance alone." Dr. Rocca indicates that the design of the current study does not provide the data needed to address the question of whether a woman's risk of parkinsonism after having both ovaries removed is altered by taking estrogen therapy. The Mayo Clinic investigators studied 1,...

MR spectroscopy may be superior for determining prostate cancer prognosis

...the April 15 issue of Cancer Research. "Our study indicates that analyzing prostate tissue's metabolic profile may give clinicians additional information about the biologic status of the disease that could allow them, in consultation with their patients, to make better-informed decisions on the next steps to ...

SKCC's Gennadi Glinsky addresses predicting risk in cancer treatment outcome

...owerful predictor of therapy outcome. Its presence indicates a short interval to disease recurrence, distant metastasis, and death after therapy in cancer patients diagnosed with 10 distinct types of cancer, including prostate, breast, lung, ovarian, bladder, lymphoma and acute myeloid leukemia. Applying compa...

Surgery for children with sleep apnea improves quality of life

...rovement in QOL was nevertheless significant. This indicates that some of the effects of sleep-disordered breathing on QOL are not measured by the PSG."...

Clinical trial of gefitinib for advanced lung cancer closes early

...ized to one of the two arms. "The interim analysis indicates that even with accrual of more patients or with longer follow-up, the gefitinib arm would not improve survival," said Laurence Baker, D.O., chairman of SWOG and professor of internal medicine and pharmacology at the University of Michigan in Ann Arbo...

New research pinpoints best treatment for stroke

...s including measuring cerebral blood volume, which indicates the severity of a blockage. About 60 percent of patients deemed candidates for intervention following CT perfusion were able to have their clots removed successfully by interarterial administration of tPA and the MERCI (corkscrew) procedure. In MERCI...

UT Southwestern sports medicine doctor pedals advice on gearing up for safe cycling season

...e, during and after a ride is essential. "Research indicates that for someone in training, carbohydrates are an important source of energy. A healthy diet would include one with 60 percent carbohydrates, less than 30 percent fats, and 15 to 20 percent protein," Dr. Palacios said. "For activities, including war...

High risk of second cancers in survivors of childhood soft tissue sarcomas

...viewed journal of the American Cancer Society, and indicates children treated with combined chemotherapy and radiation therapy, in particular, had greater risks of developing a new malignancy. With improvements in cancer treatments over the last two decades, children with soft tissue sarcomas are living longer...

New portable device developed by Georgia Tech and Emory checks for concussions on the sidelines

...oo slow or the incorrect answers were provided, it indicates impairment. The DETECT system includes a laptop to run the software, a head-mounted display, earmuffs that also act as headphones and an input device (controller). The display projects the visual aspect of the test, the headphones provide the verbal...

Access to mammography may worsen

...t that fits the profile of the rest of the country indicates that our results are reflective of national trends," Dr. D'Orsi said. Situation May Get Worse The researchers reported that staffing shortages could have significant clinical implications in the early detection of breast cancer. With fewer radiolog...

Enrollment progress for European approval trial

...85/EEC. Approval to apply the CE mark to a product indicates it can be legally sold within the European Union (EU) and the European Free Trade Area (EFTA)....

Nation's leading researchers, scientists reveal findings at occupational therapy conference

...t-Combat: Reintegrating Citizen-Soldiers Research indicates the potential long-term adverse effects of war exposure and a growing need for ongoing social support for returning veterans. As team members, occupational therapy practitioners identify strategies and resources to help reintegrate soldiers into thei...

UT Southwestern researchers show new drug may help treat certain forms of leukemia

...Ilaria said. Its relatively long half-life in mice indicates once-daily dosing might be possible in humans. PD166326 is in a different class of anti-leukemia drugs currently being investigated by other researchers for their effectiveness in Gleevec-resistant patients. Dr. Ilaria's lab is continuing research in...

Fracture risk lower for black women than white women at all bone mineral density levels

...ssue is whether evidence about ethnic differences indicates a different threshold for treating patients with the same BMD based on differences in skin color, facial features, or self-identified racial groups. This approach is fallible to the extent that race is a nonbiological category, an extremely crude sur...

1 2 3 4 5 6 7 8 9 10

(Date:6/17/2013)... CORVALLIS, Ore. Amphibian populations are declining worldwide and ... be spread by bullfrogs, but a two-year study shows ... suggestions that bullfrogs are a tolerant carrier host that ... frogs from eggs in controlled experimental conditions, they found ... dendrobatidis , also called Bd or a chytrid fungus, ...
(Date:6/16/2013)... prevention programs for female sex workers in India reduce ... (STIs), a University of Toronto study has found. ... HIV, mostly in the southern states of Andhra Pradesh, ... Professor Prabhat Jha from U of T,s Dalla Lana ... for Global Health Research (CGHR), examined the impact of ...
(Date:6/16/2013)... ago triggered a similar marine ecosystem crisis to those ... warming, according to research published today in Nature ... universities of Newcastle, UK, Cologne, Frankfurt and GEOMAR-Kiel, confirms ... the marine ecosystem during the mid-Cretaceous greenhouse period. ... amplitude and duration of the temperature change.,Analysing the geochemistry ...
Breaking Biology News(10 mins):Bullfrogs may help spread deadly amphibian fungus, but also die from it 2HIV prevention among female sex workers in India reduces HIV and syphilis 2Global cooling as significant as global warming 2
Other Tags
comparablemarimastatketektenthdarklyairwayeditsfluorideappropriationsconveysasmusualunprovengambiaopposeshivma