Tag: "inflicts" at medical news

Unrelated adults in the home associated with child-abuse deaths

... and emotional commitment to the child -- who then inflicts injury, often out of frustration" Schnitzer said. The authors suggest that subsidized child care, visits by nurses to high-risk homes, and instructional programs could reduce the risk of inflicted injury by supporting single mothers as well as prepa...

Tsunami raises questions about disaster mental health, Science reports

... the suggestion that after a natural disaster that inflicts broad trauma, a blanket offer of Western-style mental health therapy may not always be appropriate in other cultures. Was it appropriate in the areas you visited? Why or why not? Was it effective? A big part of the problem is that there's not a lot ...

1

(Date:8/28/2014)... -- Scientists have identified the developmental on-off switch for ... produce more than two-thirds of the world,s naturally derived ... to see whether it is possible to manipulate this ... , The study, appearing August 28 in Cell ... molecule called cyclic-di-GMP and a larger protein called BldD ...
(Date:8/28/2014)... method for measuring and imaging how quickly blood flows ... understand how drug abuse affects the brain, which may ... lead to better treatment options for recovering drug addicts. ... from Stony Brook University in New York, USA and ... in The Optical Society,s (OSA) open-access journal ...
(Date:8/28/2014)... the first person to alert the world to Global ... be captured and stored underground. He says that Carbon ... the best way to avoid global warming getting out ... (Columbia University, New York) made the call during his ... where 150 scientists are meeting to discuss Carbon Capture ...
Breaking Biology News(10 mins):Small molecule acts as on-off switch for nature's antibiotic factory 2Small molecule acts as on-off switch for nature's antibiotic factory 3This is your brain's blood vessels on drugs 2This is your brain's blood vessels on drugs 3Global warming pioneer calls for CO2 to be taken from atmosphere and stored underground 2
Other Tags
speedycootsovulationperimenopausalpeeksgenesystemsstrepasidewallsbumpdegradationimmunitiesbrandedpolymerpurduesexes