Tag: "mainly" at medical news

Top anti-arthritis drugs cause skin disease

...nosed 20 times; and drug eruptions, which occurred mainly at the beginning of the treatment and were important enough for 7 patients to stop therapy. In addition, 12 patients were diagnosed with skin tumour and 9 with an ulcer. In total, 26% of the patients who developed a dermatological condition ceased th...

Liver may be source of 'good' cholesterol

...n occurred throughout the body rather than coming mainly from one organ. They know that some of it is manufactured in the walls of blood vessels, for example. "These results profoundly alter our concept of how HDL is manufactured in the body and establish the liver as the single most important source of HD...

About 70 percent of older adults use alternative medicine

...conducted by the University of Michigan and funded mainly by the National Institute on Aging. The survey included 848 respondents aged 50 and over. The survey asked about the use of six types of alternative medicine: chiropractor, acupuncture, massage therapy, breathing exercises, herbal medicine, and medit...

Will cancer vaccine get to all women?

...r could jump fourfold to a million a year by 2050, mainly in developing countries. This could be prevented by soon-to-be-approved vaccines against the virus that causes most cases of cervical cancer- but there are signs that opposition to the vaccines might lead to many preventable deaths. The trouble is th...

Abnormal liver tests in a Mediterranean population

... prevalence increasing with age. The age-trend was mainly due to chronic HCV infection, which affected 6.5 percent of the study population overall and increased in prevalence with age. More men than women had elevated liver tests, which was probably attributable to greater alcohol consumption among men. Alm...

Revised Bethesda guidelines effective at identifying patients at risk of colorectal cancer

...e article. HNPCC is caused by mutations in genes, mainly MSH2 and MLH1. In HNPCC, colorectal tumors have a DNA abnormality called microsatellite instability. Although a great advance in the understanding of the molecular basis of HNPCC has taken place in the last decade, optimal selection of individuals ...

Two studies document rise of superbugs in the environment

...s aureus, or MRSA, an organism that was associated mainly with hospital-acquired infections, but is becoming...eatment accordingly. Prevention of MRSA infections mainly involves common sense. "If you get a cut or an abrasion, try to keep it clean and dry" and don't sha...

Active vaccine prevents mice from developing prion disease

...calizes the initial immune response to the gut and mainly stimulates an antibody response, says Dr. Wisniews...ccine orally, we're stimulating an immune response mainly in the digestive tract," he explains. "Thus, harmful prions in contaminated food will be destroyed i...

Black children more likely to die from traumatic injury than white children

...abilitation services. "Trauma-induced injuries are mainly a problem of prevention, not a problem of treatment," said Groner, who is also the trauma medical director at Columbus Children's Hospital. "Trauma is a disease it can be prevented and it has recognizable risk factors." The findings are reported in ...

Two-thirds of patients brush off their dentist's advice, study suggests

...ociety." "Patients must understand their health is mainly their responsibility, and if they are not going to comply with the advice of health providers like dentists who have their best interests at heart, they must accept the consequences." The Newcastle researchers are carrying out further research into h...

Over-feeding in infancy might set the stage for childhood obesity

...rs consumed more energy as carbohydrates, provided mainly by complementary food, whereas their energy intake from protein and fat was the same as that of other children. The obese mothers also spent less time feeding their children, and less time playing or interacting with them: over 24 hours the obese mot...

Iodine deficiency, supplements affect thyroid cancer risk in children exposed to radioactive iodine

Exposure to radioactive iodines, mainly iodine 131 (I-131), in childhood is associated wit... Union for goiter prophylaxis and was distributed, mainly in Belarus, to children evacuated after the Chernobyl accident. "Both iodine deficiency and iodine s...

Genes may influence nutritional composition of breast milk

...r's diet into her breast milk. DHA, which is found mainly in cold-water fish such as tuna, salmon, and mackerel, is essential for healthy brain and eye development. DHA is now added to several brands of infant formula because of research showing its beneficial effects. One study, for example, found that p...

Empathetic voice improves doctor-patient communication

...ion from patients. Dr. Cordella found that doctors mainly used three 'voices' when talking to patients: the 'doctor voice' (seeking information), 'educator voice' when seeking to inform and educate the patient about their condition, and the 'fellow human voice' when trying to get patients to talk about th...

Teenage depression can be enduring, but is more often short-lived

...n inner despair or distress, and notice depression mainly as irritability or loss of enjoyment of activities their kids used to enjoy," Hammen said. "If it goes on for a month, I think the parent should pay more attention and not just dismiss the behavior as part of adolescence." "Most of the time when chi...

Statins underprescribed to patients at higher risk of heart disease, Stanford study says

...l as effective strategies for lowering that risk - mainly through smoking cessation, a healthier diet, more exercise and medications such as statins. "The problem is that we have not been effective at turning this evidence into practice," Stafford said. Although previous studies have tracked statin use on a...

People with diabetes more sensitive to cardiovascular effects from air pollution

...tion. These included sulfate particles, which come mainly from coal-burning power plants, as well as ultra-fine particles and black carbon soot, which are generated primarily by diesel- and gasoline-powered vehicles. "Our strongest finding was that blood vessel reactivity was impaired in people with diabete...

Where life's memories are stored

...chers. "First, the patients with damage restricted mainly to the medial temporal lobe performed normally on ...normal in the five patients with damage restricted mainly to the medial temporal lobe....

Mental illness exacts heavy toll, beginning in youth

...eline NCS survey, at 13 percent. The expansion was mainly in the general medical sector, with more primary care physicians providing psychiatric services. People with mental or substance abuse disorders were more likely to get treatment from a primary care physician/nurse or other general medical doctor...

Raisins fight oral bacteria

...ities and gum disease." "Moreover, raisins contain mainly fructose and glucose, not sucrose, the main culpri...sticky do not necessarily cause tooth decay. It is mainly the added sugar, the sucrose, that contributes to the problem," Wu said....

1 2 3 4 5 6 7 8 9 10

(Date:10/16/2014)... Post-menopausal women experienced improvements in vaginal atrophy, with ... bleeding, after 12 weeks of daily 10 milligram ... nutritional supplement previously shown to help relieve certain ... study reported in a poster at the North ... , "These data documented improved vaginal epithelium, without ...
(Date:10/15/2014)... has admitted Johannes Gutenberg University Mainz (JGU) as ... hub continues to maintain a significant nationwide standing ... "The acceptance of Johannes Gutenberg University Mainz as ... milestone in the national and international competition for ... of Rhineland-Palatinate can be proud that Mainz University ...
(Date:10/15/2014)... 15, 2014   Neurotechnology , a provider ... availability of the VeriLook Surveillance 3.0 software ... real-time biometric face identification using live video streams ... The new version not only identifies faces in ... objects while they are moving through the video ...
Breaking Biology News(10 mins):S-equol supplements associated with improved measures of reproductive health in postmenopausal women 2Johannes Gutenberg University Mainz joins Germany's Gauss-Allianz as a full member 2Johannes Gutenberg University Mainz joins Germany's Gauss-Allianz as a full member 3VeriLook Surveillance 3.0 SDK Identifies Faces and Moving Objects, Differentiates Pedestrians from Other Moving Objects in Video Surveillance Systems 2VeriLook Surveillance 3.0 SDK Identifies Faces and Moving Objects, Differentiates Pedestrians from Other Moving Objects in Video Surveillance Systems 3
Other Tags
doublecortindirectingpayloadsstsmaintenancetelomerealivedrunkenapplesdevicewidelyisraeliimpactmonitoringneurodegenerativeions