Tag: "matching" at medical news

Once-a-month injectable medication helps treat alcohol dependence

... 190 mg. of long-acting naltrexone (n = 210), or a matching volume of placebo (n = 209), each administered monthly and combined with 12 sessions of low-intensity psychosocial intervention. The researchers found that compared with placebo, 380 mg. of long-acting naltrexone resulted in a 25 percent decrease in ...

Number and quality of kidney transplants much greater if national matching program adopted

...ts has mathematically demonstrated that a national matching program for kidney paired donation, also called pa...atabases, added the authors. "Clearly, a national matching program is the best solution for incompatible donors and recipients, but for such a program to be su...

Kidney donation program may provide more matches for previously incompatible recipients and donors

...ore, and colleagues developed a novel kidney donor matching algorithm using optimization, a mathematical techn...le donor/recipient pairs to determine if their new matching algorithm might improve matches that can be found in a small (regional) or large (national) pool. T...

CONRAD receives $24 million from Gates Foundation and USAID for HIV microbicide trials

...ll & Melinda Gates Foundation, with $12 million in matching funds committed by the US Agency for International Development (USAID), for a total of $24M. This grant plus the USAID award will allow two multi-country Phase III clinical trials of a product to prevent the transmission of HIV/AIDS. The main goal...

Soliciting organs over the Internet

...rnet," which will bring together an Internet donor matching service MatchingDonors.com and ethicists to discuss the changing landscape of organ donation. The event will be held at HMS in the Tosteson Medical Education Center on Thursday, May 12. The great majority of organ transplantation occurs under the m...

Immune system lab model overcomes ethical limits on human hematopoietic stem cells studies

...f DNA cut out of chromosomes during the mixing and matching of genes that are chosen to build a particular receptor. Each T cell uses the resulting combination of genes to make a receptor that lets the cell recognize a specific target. When stimulated to multiply, each parent T cell produces an army of identi...

Infants with rare genetic disease saved by cord blood stem cells

...eas adult bone marrow requires a greater degree of matching antigens, she said. As a result, a cord blood don...e identified and obtained within a week, whereas a matching adult donor can takes months to locate and obtain if available at all, said Kurtzberg. Similar benef...

Female lung transplant recipients at greater risk of acute lung injury

...nd reason for lung transplant, as well as the size matching between the donor and recipient. Overall, approximately 10% of transplant recipients suffered from primary graft dysfunction, which is an acute severe lung injury that occurs within the first 72 hours after the transplant and has a high mortality. O...

Key milestone in antifungal treatment for severe asthma

... or more fungi, allocated itraconazole capsules or matching dummy capsules for 8 months. So far 26 patients (25% of the total required) have been enrolled. Allergy to fungi is relatively common, affecting asthmatics, those with cystic fibrosis and others with chronic sinusitis (usually with nasal polyps). ...

New base for North American cancer screening pioneers

...ant from One NorthEast was made possible through a matching investment by parent company Genesis Canada of over 850,000, which intends to employ up to 15 people in the first instance at its Newcastle base." David Allison, One NorthEast Director for Business and Industry, said: "I am delighted that Genesis Gen...

NMR method rapidly solves 8 target genomic structures

...intenance of the NMR facility, as well as generous matching funds to purchase a new ultra-sensitive cryogenic NMR probe, which boosts the instrument's sensitivity....

UCF tops $100 million milestone in research funding for 2004-05

...and the support provided by the university through matching funds and also start-up grants that help newly hired professors equip their labs. Other matching funds are provided through the Florida High-Tech Corridor Council. Longtime faculty members and admi...

New finding may aid adult stem cell collection

...n bone marrow or adult stem cells are taken from a matching donor and injected into the patient after radiatio...cipient's own tissue, and 15,000 using tissue from matching donors....

New drug reverses effects of sleep deprivation on brain

...esearchers first tested normal, alert monkeys on a matching task similar to a video game. Each monkey was show...ain activity while the animals were performing the matching task. These scans showed that the drug was able to reverse most of the changes in activity patterns ...

High exposure to motor oil increases chances of developing arthritis

...ith RA and reporting high exposure, as well as 132 matching controls, was retained for further study. Sverdrup et al.'s results show that men highly exposed to motor or hydraulic oil have a 30% higher risk of developing RA than unexposed men. Exposure only increased the risk of developing 'rheumatoid factor p...

Hopkins study shows living kidney 'paired donation' an effective strategy in overcoming donor-recipient incompatiblities

...patients whose willing donors were incompatible by matching them up with other incompatible pairs. Robert Mont... said the results could pave the way to a national matching registry that would enable hundreds and perhaps thousands of patients who cannot receive a kidney fr...

Use of kidney paired donation for incompatible donors could expand donor pool

...ing a matched pair difficult. Regional or national matching programs would make finding pairs more probable, but including the highly sensitized blood type O candidates would require extensive laboratory testing." "However, there are several important cautions. While transplant physicians see the tremendous b...

Men who smoke heavily may impair sperm, fertility

...lf, placing one half with a smoker's sperm and the matching half with control sperm. After two to three hours of incubation, researchers counted the number of sperm attached tightly to the outside of each half. The number of attached sperm from the smoker was compared to the control number, which gave a r...

The Gerontological Society of America awards new Hartford Doctoral Fellowships

...ceive a $50,000 dissertation grant plus $20,000 in matching support from their home institutions that will enable them to more fully concentrate on their dissertation research projects over the next two years: James Masten New York University School of Social Work Dissertation Title: "Aging with HIV/AIDS: Th...

ERS altimeter survey shows growth of Greenland Ice Sheet interior

...tion-change rate is minus 2.0 cm per year, broadly matching reported thinning in the ice-sheet margins. The trend below 1500 metres however does not include the steeply-sloping marginal areas where current altimeter data are unusable. The spatially averaged increase is 5.4 cm per year over the study area, w...

1 2 3

(Date:5/21/2013)... battle? Try staying fit in space, where living quarters ... , That,s the challenge a group of Michigan State ... million grant from NASA. Their goal is to keep ... "You could give astronauts the best exercise regimen there ... to it, it isn,t going to help," said project ...
(Date:5/21/2013)... biomass experts , Where? Copenhagen, Denmark: ... 03-07 June 2013 , Why? ... market and policy developments, manufacturing and installation, drawing on ... from its 2013 edition from a record of more ... more than 240 plenary and oral presentations, more than ...
(Date:5/21/2013)... The epigenetic modifications, which alter the way genes ... apparently be detected in the blood of pregnant ... way to foretell depression in the weeks after ... symptoms become debilitating. , The findings of the ... online in the journal Molecular Psychiatry . ...
Breaking Biology News(10 mins):Fueling fitness on the final frontier 221st European Biomass Conference and Exhibition 221st European Biomass Conference and Exhibition 321st European Biomass Conference and Exhibition 4Genetic predictors of postpartum depression uncovered by Hopkins researchers 2Genetic predictors of postpartum depression uncovered by Hopkins researchers 3
Other Tags
deficitmammarymissilesguidedcoloradoinfluencesculturealoneopensdocumentedruinousmethamphtetamineflycheckfacedmetacognition