Tag: "morale" at medical news

UK politicians failing to address low morale among doctors

...vices in their election campaigns--the collapse in morale among doctors, states an editorial in this week's ...ent. Doctors want to strengthen their professional morale because they know that a more robust and motivated profession will mean better outcomes for patients...

Mental illness exacts 'enormous toll' for US businesses and institutions

... a ripple effect in the work setting, creating low morale among coworkers and a higher turnover rate. Lead author Alan Langlieb, M.D., M.P.H., an assistant professor of psychiatry, examined more than 100 published studies exploring how mental illness affects the workplace. "After reviewing and analyzing the...

1

(Date:8/28/2014)... -- Scientists have identified the developmental on-off switch for ... produce more than two-thirds of the world,s naturally derived ... to see whether it is possible to manipulate this ... , The study, appearing August 28 in Cell ... molecule called cyclic-di-GMP and a larger protein called BldD ...
(Date:8/28/2014)... method for measuring and imaging how quickly blood flows ... understand how drug abuse affects the brain, which may ... lead to better treatment options for recovering drug addicts. ... from Stony Brook University in New York, USA and ... in The Optical Society,s (OSA) open-access journal ...
(Date:8/28/2014)... the first person to alert the world to Global ... be captured and stored underground. He says that Carbon ... the best way to avoid global warming getting out ... (Columbia University, New York) made the call during his ... where 150 scientists are meeting to discuss Carbon Capture ...
Breaking Biology News(10 mins):Small molecule acts as on-off switch for nature's antibiotic factory 2Small molecule acts as on-off switch for nature's antibiotic factory 3This is your brain's blood vessels on drugs 2This is your brain's blood vessels on drugs 3Global warming pioneer calls for CO2 to be taken from atmosphere and stored underground 2
Other Tags
speedycootsovulationperimenopausalpeeksgenesystemsstrepasidewallsbumpdegradationimmunitiesbrandedpolymerpurduesexes