Tag: "neurobehavioral" at medical news

A first glimpse at healthy brain and behavioral development

...hild's brain and to link the imaging findings with neurobehavioral function. ...

Many children discontinuing use of ADHD medication

...pecialists in Pediatric Nursing. ADHD is a common neurobehavioral disorder, affecting 4.4 million children in the United States between the ages of 4 and 17. Following diagnosis, 56% are treated with prescription stimulant medications. According to the study, many stop using these medications even while they are st...

Recovering alcoholics with poor sleep perceptions will likely relapse

...d Hospital, as well as professor of psychiatry and neurobehavioral sciences at Wayne State University School of Medicine in Detroit, "alcoholics perceive their sleep is disturbed and that is the reality. The clinician should pay attention to the alcoholic's sleep complaints as the complaint of poor sleep predicts r...

Innovative surgery corrects vision in kids with neurological disorders

...on children with cerebral palsy, Down syndrome and neurobehavioral disorders such as autism. To date, St. Louis Children's Hospital is one of the only U.S. medical centers performing refractive surgery on these children and has the highest volume, operating on about 60 special-needs children a year. "We work with ...

Decision-making impairment appears greater in alcoholics with coexisting personality disorders

...Impaired decision making is regarded as one of the neurobehavioral hallmarks of addiction. New research has found that alcoholics with certain coexisting personality disorders (PDs) have decision-making abilities that are particularly impaired. Results are published in the October issue of Alcoholism: Clinical ...

Alcoholism-treatment medication acamprosate may help abstinent alcoholics sleep better

...d Hospital, as well as professor of psychiatry and neurobehavioral sciences at Wayne State University School of Medicine in Detroit. "This would be the first study of its kind to show positive effects of acamprosate on sleep disorders." The seemingly greater popularity of acamprosate in Europe, noted Staner, is ...

Penn researchers find many commercial drivers have impaired performance due to lack of sleep

...eep a night on a regular basis. "There are daytime neurobehavioral performance impairments that are found commonly in commercial drivers, and these are more likely among those who get an average of five or less hours of sleep a night and those who suffer from severe obstructive sleep apnea," the researchers conclude...

M. D. Anderson: Setting the benchmark in brain tumor treatment

... "Unfortunately, even subtle impairments of neurobehavioral functioning can reduce the patient's ability to function in his or her usual family and social roles," she says. For example, Meyers says that the majority of brain tumor patients nationwide do not return to work, and many require a full-time or near...

Neuropsychological function of kids with cavities filled with mercury-containing amalgam

... significant differences in neuropsychological and neurobehavioral effects among children whose dental caries were treated with mercury amalgam fillings and those treated with a composite dental restorative material, according to two studies in the April 19 issue of JAMA. Dental (silver) amalgam is a widely used res...

AIDS-related cognitive impairment exists in two separate forms

...ontrol subjects. Participants completed a detailed neurobehavioral evaluation, which included neuropsychological testing to assess what level of cognitive impairment they had, and underwent an anatomical MRI scan. Using the data from the neurological tests, each participant was classified as either normal, mildly im...

Lead exposure plus high blood pressure may impair mental ability

..., blood lead level, and C-reactive protein." Other neurobehavioral tests included measures of reaction time and reaction time variance. Results suggested slower and less stable reaction time associated with increases in pulse pressure and blood lead levels. Additional findings suggested that socio-economic status a...

Long residency hours linked with impaired performance similar to effects of drinking alcohol

...all rotation and long hours, effects on residents' neurobehavioral performance are comparable to the impairment assoc...igan, Ann Arbor, and colleagues compared post-call neurobehavioral performance of 34 medical residents (18 women, 16 men) after their rotations to examine the effect o...

No strong evidence linking mercury levels with worse neurobehavioral performance in older adults

...become elevated with fish consumption, and adverse neurobehavioral effects, according to a study in the April 20 issu... examine associations between mercury exposure and neurobehavioral outcomes in a representative sample of older adults in the United States. The research included 474...

1

(Date:4/17/2014)... hundred births, Down syndrome - or trisomy 21 - ... It results from a chromosomal abnormality where cells of ... (1% of the human genome). A study conducted by ... Genetic Medicine and Development at the University of Geneva ... shed light on how the extra chromosome 21 upsets ...
(Date:4/17/2014)... Clemson professor Rajendra Singh Thursday as a "Champion ... expand solar deployment in the residential, commercial and ... Professor of Electrical and Computer Engineering and director ... a local hero leading the charge across the ... solar power and driving policy changes at the ...
(Date:4/17/2014)... such as heart disease, epilepsy and pain, making them ... is still much scientists do not know about the ... into the structure of sodium channels and, specifically, one ... responsible for ,fine-tuning, the activity of the channel. The ... the Journal of Biological Chemistry . , Nerves ...
Breaking Biology News(10 mins):Trisomy 21: How an extra little chromosome throws the entire genome off balance 2Trisomy 21: How an extra little chromosome throws the entire genome off balance 3White House honors Clemson professor as 'Champion of Change' for solar deployment 2Structure of sodium channels different than previously believed 2
Other Tags
architectsbeaverrunawaycaspaseclindamycinplentifulpertussisimmunogenicityallergenillnessessupplementsherbalprofessorshipbassetspaceddocument