Tag: "potassium" at medical news

Execution by lethal injection is not humane or painless suggests study

...ncuronium bromide to induce paralysis, and finally potassium chloride to stop the heart and cause death. Without anaesthesia the person would experience suffocation and excruciating pain without being able to move. Leonidas Koniaris (University of Miami Miller School of Medicine, USA) and colleagues analysed ...

Comprehensive treatment improves cognitive impairment in heart failure patients

...gnitive dysfunction. Low serum albumin, sodium and potassium levels, hyperglycemia, anemia, and systolic blood pressure levels were independently associated with cognitive impairment. According to Dr. Giuseppe Zuccal, "The issue of cognitive impairment associated with heart failure does not represent a mere ac...

Medication errors continue even in highly computerized hospital

...d adverse drug reactions, for example, prescribing potassium with diuretics to avoid a low potassium level (36 percent); failure to start or complete adequate monitoring for common adverse drug reactio...

K-State researchers designing better drug to treat cystic fibrosis

... said. "Sodium is usually higher outside the cell, potassium is higher inside the cell and chloride, depending ..." he said. "The mechanisms determining how sodium, potassium and calcium get across are much better known. We're trying to find out how chloride actually gets ac...

Pedialyte and Gatorade equally effective in alleviating effects of viral gastroenteritis in children

...ehydration solution with carbohydrates, sodium and potassium for 48 hours. The children also received a diet o...rant from The Gatorade Sports Science Institute. A potassium deficiency, known as hypokalemia, persisted in a few patients receiving Gatorade after 48 hours. P...

Healthy diets rich in protein and good fat, and lower in carbs linked to better heart health

...and sodium, and rich in fruits, vegetables, fiber, potassium and other minerals. However, one diet was a traditional healthy diet, rich in carbohydrate, while in the other two diets approximately 10 percent of its calories from carbohydrate were replaced with either monounsaturated fat or protein. In the pro...

Connective tissue cells from lungs fused with heart muscle to form biological pacemaker

...been altered by adding HCN1, a gene that codes for potassium ion channels, and another gene, If, which produces...usion, the cells showed signs of forming their own potassium ion channels and began generating their very own electrical current, one much like the heart's natur...

Less-invasive ultrafiltration device may be practical alternative to diuretics

... drugs drain electrolytes from patients, including potassium and magnesium, and it can be difficult to determine the proper dose for each patient. A practical, safe and effective ultrafiltration device could be an attractive alternative to diuretics. "Ultrafiltration has been available for many years. In the p...

One in five patients on commonly prescribed diuretics have abnormal sodium and potassium levels

...or heart conditions end up with reduced sodium and potassium levels, according to a study published in the Janu...002, but only 32 per cent had had their sodium and potassium levels recorded electronically. The drug most commonly prescribed was bendroflumethiazide (bendrofl...

Hormone linked to good hearing as we age

...crucial signaling chemicals in the nervous system, potassium and sodium. For nerves to send signals crisply and work properly, potassium and sodium must be in precise proportion, without any disruption in the molecular channels or gates ...

Study ties 'new' cell-death mechanism to developmental and degenerative brain disorders

...rincipal investigator of this study. KCNC3 forms a potassium channel, part of a biochemical mechanism that regu... electrical impulses of bursting neurons. Although potassium channel mutations have previously been linked to episodic disorders such as seizures, this is the fi...

Einstein scientists discover cause and possible treatments for hereditary movement disorder

...as traced to reduced activity of calcium-activated potassium channels in Purkinje cells -- a direct consequence...improved significantly. "These calcium-activated potassium channels proved to be a potent therapeutic target, since chronically activating them with EBIO defin...

Now is a pivotal point in history to abolish state execution

...n of pancuronium to paralyse breathing muscles and potassium chloride to stop the heart, 21 of 49 executed US i...sciousness before the injection of pancuronium and potassium chloride, in order to avoid excessive pain. As a result, Californian officials have had to postpone ...

Controlling your (nerve) impulses

...8 issue of the Journal of Neuroscience. Sodium and potassium are salt molecules (or ions) found throughout the body. Cells pump extra potassium into their interiors, and pump extra sodium out to the surrounding fluid. Electrical impulses in neu...

Heart therapy studies highlight advantages of keeping it simple

... many salt substitutes, which consist primarily of potassium chloride and leave a bitter after-taste, the salt ...5 percent sodium chloride (table salt), 35 percent potassium chloride, and 10 percent magnesium sulfate. At the beginning of the study, blood pressure averaged ...

Medications that lower blood pressure linked to reduced risk of Alzheimer's disease

...lear, the authors suggest that the increased blood potassium levels associated with the medications may be a fa... unpublished findings also suggest that increased potassium levels may be associated with a reduced risk of dementia," they write. "Consistent with this idea a...

Researchers identify potential targets for new pain therapies

...ssue of the journal Neuron the identification of a potassium channel that plays a crucial role in what scientis...eurons is produced by subtle changes in the cell's potassium concentration. To maintain correct amounts of potassium, cells are equipped with proteins that poke ...

Protein's potential as a regulator of brain activity discovered

...it the function of "pumps" that control sodium and potassium levels within cells. These pumps, called sodium-po...o this by pumping sodium out of a cell and pumping potassium in, setting up an electrochemical gradient -- in a sense, turning the cell into a battery. If this a...

New guidelines offer power to prevent stroke

...iabetic patients with statins, Increase intake of potassium and reduce salt intake to lower blood pressure in people with hypertension, Start transcranial Doppler (TCD) ultrasound screenings for children with sickle cell disease at age 2 and consider transfusion therapy for those found to be at high stroke r...

Corticosteroid therapy may be associated with irregular heartbeat

...s write. The medication may affect the balance of potassium in heart muscle cells, which in turn causes the muscle to contract irregularly. Corticosteroids also may cause retention of sodium and fluid, which can lead to high blood pressure, congestive heart failure or enlarged atria, all risk factors for atr...

1 2

(Date:8/22/2014)... , August 22, 2014 /PRNewswire/ ... http://www.researchandmarkets.com/research/mtm27l/biometrics_market ) has announced the addition ... America 2014-2018"  report to their offering.  ... , ,Biometrics is a technology that ... based on their physical or behavioral ...
(Date:8/22/2014)... a leading source of information for businesses and professionals, ... Riverside in its 2014 list of "some of the ... generate the list, the company analyzed citation data over ... has had enormous impact. , The following UC Riverside ... the greatest number of highly cited papers in one ...
(Date:8/22/2014)... Jolla, CA Research presented at the 29th ... being developed by Hera Therapeutics Inc. combats three ... cause 70 percent of all cervical cancer. , ... HTI-1968 blocked the replication of HPV-16, HPV-18 and ... and Thomas Broker, Ph.D., who presented the findings ...
Breaking Biology News(10 mins):Biometrics Market in North America 2014-2018: Key Vendors are 3M Cogent, Cross Match, NEC and Safran SA 2Biometrics Market in North America 2014-2018: Key Vendors are 3M Cogent, Cross Match, NEC and Safran SA 35 UC Riverside scientists among world's most influential scientific minds 2
Other Tags
hatchedmurreletmarbledswarmseelgrassisotronspaceswhiffiestdevicewidelyisraelilaunchvanasmebioengineerafraid