Tag: "pregnancy" at medical news

Low intake of milk in pregnancy associated with decreased birth weight

...tudy, women whose daily consumption of milk during pregnancy was 1 cup (250 ml) or less consumed less protein a...drank more milk. Milk and vitamin D intakes during pregnancy were found to be each associated with infant birth weights, independently of other risk factors. In...

Prenatal alcohol exposure can alter circadian rhythms in offspring

...sage, said Thomas, is that drinking alcohol during pregnancy can have long-lasting damaging effects to the offspring. "There is currently no known safe amount of alcohol that can be consumed during pregnancy, so it is best to abstain from alcohol drinking during pregnancy. We need to better understand the me...

Preconception health care can improve the lives of mothers and babies

... medical visits can help identify risk factors for pregnancy complications and adverse birth outcomes, allowing...nd babies if we could identify risk factors before pregnancy and educate women about what health changes they can make," said Janis Biermann, co-author of the st...

Very long or short intervals between pregnancies associated with increased poor perinatal outcomes

...onths between pregnancies. Infants of mothers with pregnancy intervals longer than 59 months had a 20 to 43 per...ise women on the benefits of delaying a subsequent pregnancy for approximately two to five years to improve the health of both mother and the next infant."...

Free-electron laser targets fat

...ss they pass an initial screening and two negative pregnancy tests. The program also requires patients to promi...e two forms of contraception and submit a negative pregnancy test result each month while on the drug. Dr. Anderson also envisions that laser treatments could e...

St. John's wort, Echinacea interfere with some drugs by moving them out of the body too fast

...linical indication of decreased protection against pregnancy by the oral contraceptive. Dr. Gorski now is studying the impact of St. John's wort on antihistamines and other pharmaceutical drugs. Dr. Gorski began his research with Echinacea, a herbal preparation often touted for its ability to prevent or treat ...

Significant improvement noted in diabetes management using chronic care model

...ion. Women who develop gestational diabetes during pregnancy have a substantially increased risk of acquiring the disorder later in life, and women who have diabetes before becoming pregnant face a higher risk of complications for themselves and their babies. One out of every 10 health care dollars is spent on...

Differences in pregnancy risks and outcomes among immigrant groups to the US

...workers to assess the risk factors associated with pregnancy outcomes in these ethnic groups. A study in the M...on and completion of high school, low-risk of teen pregnancy and substance abuse, although they have a higher rate of low birth weight and small for gestational ...

Mom's nutrition during pregnancy related to child's behavior at age three

...ing evidence that a mother's nutritional status in pregnancy also affects the behavior and personality of the c... collected from the mothers at 16 weeks into their pregnancy showed that the majority, 58 percent, was iron deficient, including 10 percent who were actually ane...

Daughters of Indian immigrants continue trend of giving birth to small babies

...e indicators we have traditionally used to predict pregnancy outcomes - maternal educational level and age, and...hers call the previously identified differences in pregnancy outcomes between Indian and Mexican immigrants the "dual paradox." That's because Mexican women givi...

HIV infection rates down one-third in south India, University of Toronto study

...tracked HIV prevalence among young women attending pregnancy or antenatal clinics in India's southern and north...illance, including more questions on risk factors, pregnancy history, husband's history and additional STI testing via antenatal clinics and other sites, is a po...

Vitamin C and E supplements do not prevent pre-eclampsia in pregnant women at risk

...nd half placebo daily from the second trimester of pregnancy until delivery. They found that the incidence of p...er, there was no evidence that women taking normal pregnancy multivitamin preparations increased the risk of low birthweight babies or caused any harm. Professor...

Panel finds insufficient evidence to recommend for or against maternal-request Caesarean delivery

...e panel defined CDMR as a Caesarean delivery for a pregnancy with a single baby at the mother's request when sh...MR should not be performed before the 39th week of pregnancy or without verification that the fetus' lungs have matured sufficiently to avoid newborn respiratory...

Pregnant women should not ignore breast cancer symptoms

... that symptomatic breast cancer that occurs during pregnancy can be imaged, diagnosed and treated while pregnan...have suspicious symptoms." Hormonal changes during pregnancy and lactation create an increase in breast volume and firmness, making detection of breast masses di...

UC Berkeley team helps win approval for life-saving drug for African women

...de, one maternal death defined as death caused by pregnancy or childbirth occurs every minute: Ninety-nine percent of all these deaths happen in developing countries. Of the many causes of maternal death, PPH holds the top spot, accounting for one in four. Risk factors for PPH include malnourishment, anemia,...

UC Berkeley study finds in utero arsenic exposure tied to lung disease and cancer in adults

...n exposed to high concentrations of arsenic during pregnancy experience six-fold increases in stillbirths and other adverse effects. Arsenic is particularly prevalent in Region II, a province in the north of Chile and one of the driest places on earth. In 1958, the cities there of Antofagasta and neighboring ...

Public education key to reducing genetic diseases linked to close-kin marriage

... diagnosis, prenatal diagnosis, and termination of pregnancy for severely affected foetuses (within the allowed limits in religion) should also be integral parts of the strategy to reduce prevalence of genetic disorders and birth defects. The application of this strategy, however, should be accompanied by care...

Medication plus oral contraceptive may improve female pattern hair loss

... loss. The contraceptive was necessary to prevent pregnancy in women in the study, because finasteride is known to cause birth defects. The researchers selected a type of contraceptive that reduces levels of male hormones, because that effect may also contribute to the treatment of hair loss. They took phot...

Small birthweight and premature births associated with higher risk of child abuse

...both of which are known to influence the length of pregnancy and a baby's birthweight. The authors are quick to point out that their study was not designed to find out if low birthweight and premature birth predispose to subsequent abuse. But they suggest that premature or small birthweight babies may have cha...

Pregnancy complications increase women's risk of heart disease, death

...acterized by a sharp rise in blood pressure during pregnancy and may be accompanied by edema (swelling) and kid...at mothers who continue to smoke cigarettes during pregnancy are not only harming health of the developing fetus but are doubling their own risks of dying from f...

1 2 3 4 5 6 7 8 9 10

(Date:11/21/2014)... , Nov. 20, 2014   Atmel® Corporation ... in microcontroller (MCU) and touch technology solutions, today launched ... sensors with the widest V cc range ... temperature accuracy and faster I 2 C bus communication ... serial EEPROM memory making them ideal for consumer, industrial, ...
(Date:11/18/2014)... 2014   EyeLock Inc. , a market ... MorphoTrust USA (Safran), a leading U.S. provider ... strategic partnership to offer comprehensive biometric identity solutions ... airport screening and financial services markets. ... consumers through a nationwide network of 1,100 IdentoGO® ...
(Date:11/10/2014)... began appearing on U.S. store shelves in early 2010, ... since. The small packets can be tossed into a ... liquid or powder. The convenience, though, has come with ... researchers at Nationwide Children,s Hospital found that from 2012 ... 17,230 children younger than 6 years of age swallowing, ...
Breaking Biology News(10 mins):Atmel Launches Industry's First Wide-V(cc) Low-Power Temperature Sensor Family 2Atmel Launches Industry's First Wide-V(cc) Low-Power Temperature Sensor Family 3Atmel Launches Industry's First Wide-V(cc) Low-Power Temperature Sensor Family 4EyeLock, MorphoTrust Form Strategic Partnership to Pursue Commercial Enterprise Deployments 2EyeLock, MorphoTrust Form Strategic Partnership to Pursue Commercial Enterprise Deployments 3Study finds laundry detergent pods, serious poisoning risk for children 2
Other Tags
interactivemucolipidosisregularlyace2elbowtenniscushingpituitaryusgsagigrapefruitreleasewishespacemakerafghanistanreturning