Tag: "provided" at medical news

Sucampo submits new drug application for lubiprostone

...d Takeda reached an agreement in October 2004 that provided Takeda marketing rights for the U.S. and Canada fo... supply the drug. For the NDA application, Sucampo provided results from two Phase III pivotal efficacy studies, results of a randomized withdrawal (RW) study a...

Last call for Annual World of Children award nominations

...established The Haitian Health Foundation, and has provided medical services and community development assistance to more than 200,000 people in rural villages and slums in Haiti. He also sends 1,500 children to schools annually. Rona Martin, Harare, Zimbabwe, Africa has played a major role in developin...

Pezcoller Foundation-AACR International Award for Cancer Research

...tant aspect of enzyme regulation. This background provided Cantley with insight into the biochemical, structu...numerous laboratories has supported this model and provided evidence that PI3K plays a critical role in many human cancers. In addition, research from Cantley...

In treatment of depression, cognitive therapy and medication both effective

CHICAGO Cognitive therapy, when provided by an experienced therapist, may be as effective a...more severely depressed outpatients, at least when provided by experienced cognitive therapists."...

Early home environment and television watching influence bullying behavior

...plications," the authors conclude. "First, we have provided some empirical support to theories that suggest that bullying might arise out of cognitive deficits as well as emotional ones. Second, we have added bullying to the list of potential negative consequences of excessive television viewing along with ob...

It takes a village to improve the health of children

...essor of clinical pediatrics, and other co-authors provided examples of training programs and strategies for involving pediatricians in community health issues. No single best-practice training model exists, nor should it, for each community and each residency training program is different in its resources an...

Risk of HIV transmission highest in early stage of infection

... was uninfected and monogamous. Study participants provided a blood sample and answered questions about their ...evention, condoms and access to STD treatment, all provided at no cost. In an accompanying editorial, Myron S. Cohen and Christopher D. Pilcher of the Universi...

Fink receives National Pharmacy Leadership Award

...rship Award. The award is the highest recognition provided by the national pharmacy leadership society for pharmacists and places recipients among the top leaders of the profession. The award was presented during the Phi Lambda Sigma (PLS) Awards Luncheon on April 4, during the American Pharmacists Associa...

Study reveals drinking alcohol reduces breast milk supply in women

...ealthy breastfeeding women. Breast stimulation was provided by an electric breast pump and the hormonal responses were measured after they consumed a moderate dose of alcohol (0.4 g/kg). The results showed a significant decrease in oxytocin level, which correlates with the decline of milk ejection and produc...

New health information resource from Tufts for Asian-language speakers

... the information that was needed. Material is also provided in English so that an English-speaking physician o.... "To complete the circle, the information is also provided in English it's one stop for essential health information for Asian Americans whose native language...

Scientists to study actions of botanical oils

...h," said Chilton. "By funding this center, NIH has provided us with an incredible opportunity to determine the therapeutic potential of fatty acids found in several natural oils to treat sufferers of many of the most common diseases that affect mankind." According to the National Institutes of Health, of whic...

Competition in health care may not result in better quality

...ers' opinions about their health care and services provided by their health plan and its affiliated physicians. Other managed care programs, such as PPOs (Preferred Provider Organizations), should be studied as well, but similar data is not routinely collected for these other insurance options and hence is no...

Institute of Medicine news: Review of HIVNET 012 study

.... In addition, the committee reviewed information provided by NIH, the original investigators, previous audits of the trial, and other information brought to its attention. The findings of the HIVNET 012 study previously underwent audits by Westat Corp. and by NIH's Division of AIDS (DAIDS). The Hopkins and...

Liver may be source of 'good' cholesterol

...ly no "good" cholesterol. "In studies of mice, we provided the first definitive proof that the liver is the source of about 80 percent of the high-density lipoprotein (HDL), or 'good' cholesterol, that circulates in the blood," said John S. Parks, Ph.D., senior researcher, from the school of medicine, which ...

Case finds dental patients agreeable to tobacco interventions

...r smoking or chewing habits. The information also provided an opportunity for Victoroff to incorporate the findings in the dental classes she teaches and to strengthen the need for dentists to overcome any hesitations they have about introducing tobacco cessation information and advice during dental visits. ...

Older children may benefit from treatment for lazy eye

...lyopia at 49 clinical sites. All the patients were provided with optimal optical correction (children who already had glasses were given new ones). Children were then randomly assigned to receive treatment for amblyopia or to receive optical correction alone. Children aged seven to 12 in the treatment group w...

Columbia research suggests need to rethink causes of heart failure

...er's Donald King, professor emeritus of radiology, provided an accurate measurement of heart shape. The other studies just measured heart width, but Dr. King's 3-D echocardiography system also measured heart length, proving that these patients did not have smaller hearts, as previously believed. Prior to t...

Rats with migraines provide Jefferson scientists insights to improved drug strategy

...reatments work. In recent experiments, the animals provided evidence showing that DHE, a standard drug currently used to treat acute migraine pain can also work against the onset of a phenomenon called "central sensitization," or "allodynia," which involves, as most migraine sufferers know, a heightened sensi...

Clinical diagnosis of Alzheimer's may be delayed, says major clinical trial

...mary support from the NIA, with additional funding provided by Pfizer, Inc., and Eisai, Inc. Pfizer and Eisai ... the donepezil study medication, and vitamin E was provided by DSM Nutritional Products, Inc. The report will appear in the June 9, 2005, print version of The N...

Independent voice rises to help consumers navigate health care

...esolve the consumers' problems, they almost always provided consumers with necessary information," said study co-author Michael R. Cousineau, Dr.P.H., director of the division of community health in the Department of Family Medicine. "In cases where consumers felt their share of medical expenses was too high...

1 2 3 4 5 6 7 8 9 10

(Date:10/31/2014)... good for attracting species, but it may not be enough ... study has found. , The researchers surveyed two types of ... abundance of two insects that interact with them. They found ... and black walnut, they didn,t find a corresponding abundance of ... the walnuts and black cherries and a type of wasp ...
(Date:10/31/2014)... 30, 2014  HITLAB SM , a healthcare ... its inaugural HITLAB Innovators Summit SM on ... HITLAB will partner with the Clinton Foundation,s Health ... ProtoHack, Columbia Business School Alumni Club of ... Engineering and Operations Research, bringing together leaders in ...
(Date:10/30/2014)... 2014—Oligonucleotide-based therapeutics present unique challenges when it comes ... developmental harm. New consensus guidelines for toxicity testing ... biological characteristics of these novel biopharmaceuticals are presented ... journal from Mary Ann Liebert, Inc. publishers ... Nucleic Acid Therapeutics website until November ...
Breaking Biology News(10 mins):Green spaces don't ensure biodiversity in urban areas 2HITLAB Announces Inaugural HITLAB Innovators Summit 2HITLAB Announces Inaugural HITLAB Innovators Summit 3New guidelines for reproductive & developmental toxicity testing of oligonucleotide drugs 2
Other Tags
despiteeasyfrogsdeformedarrivestartpartyamokcorporateresponsibilitywalkspercentageaffectingfundsaimssporting