Tag: "psychiatric" at medical news

Researchers suggest new direction for development of psychotropic drugs

...Because of limitations in animal models of complex psychiatric disorders like schizophrenia, investigators were often not discouraged by negative results in key tests, particularly if other data seemed encouraging. Roth was surprised by his own findings: "When reviewing this data, we found that animal models we...

Postpartum depression is a major public health problem that requires more resources

...rly vulnerable time for developing or exacerbating psychiatric illness, say University of Pittsburgh School of Me..., in response to a large Danish study of perinatal psychiatric episodes, calls for greater attention to the mental health of mothers and education, screening and t...

First-time mothers at increased risk for postpartum mental disorders

... 658 men were admitted with a mental disorder to a psychiatric hospital during the first 12 months after parentho...e mother. Risk for mothers was also increased for psychiatric outpatient contacts through the first 3 months after childbirth, also with the highest risk occurrin...

High risk of chronic health conditions plagues those with schizophrenia

...nt, affecting both quality of life and delivery of psychiatric and medical services. "This work highlights the need for integrated medical and psychiatric care, and the long-term deleterious effects on physical health of living with chronic mental illness...

Child abuse and neglect associated with increased risk of depression among young adults

...evated risk of major depressive disorder (MDD) and psychiatric illness, compared with matched control subjects, when followed up into young adulthood. The study included 676 children with substantiated cases of physical and sexual abuse and neglect before the age of 11. They were matched based on age, race, s...

Sleep disturbances, nightmares are common among suicide attempters: Journal Sleep

...es of 18-68, who were admitted to medical units or psychiatric wards at Sahlgrenska after a suicide attempt. It was discovered that 89 percent of subjects reported some kind of sleep disturbance. The most common complaint was difficulties initiating sleep (73 percent), followed by difficulties maintaining slee...

Youth are receiving shorter inpatient stays for mental health treatment

...ient stays at Bradley Hospital, the nation's first psychiatric hospital for children and adolescents, seem to concur with this study. "While the average length of stay at Bradley Hospital is a bit longer than what's found in the study, we've seen the trend toward shorter lengths of stay occur over the last de...

Dogs may be responding to psychological seizures, not epilepsy seizures

...ditions. "People with psychogenic seizures need psychiatric evaluation and appropriate treatment, not a specia...s said. "People with nonepileptic seizures require psychiatric evaluation and behavior therapy. This study demonstrates the importance of establishing an accurate ...

HIV medical providers unite to advocate for patient care

...but we dont have the funds or personnel to provide psychiatric or substance abuse treatment. We end up sending fragile patients into a complex and collapsing public mental health system." She says one such patient has seen four different psychiatrists in the last year. "Congresss neglect of Title III provid...

Study links attempted suicide with genetic evidence identified in previous suicide research

...and her team -- DNA samples, medical histories and psychiatric evaluations -- came from an independent study, CHIP, conducted at the University of Chicago, Johns Hopkins, and the National Institute of Mental Health (NIMH) Intramural Program. The purpose of CHIP, initiated in 1988 and funded through at least 2010...

Penn researchers find that chronic dizziness may be caused by psychiatric and neurologic illnesses

... "All but six patients were diagnosed as having psychiatric or neurologic conditions, including primary or sec...re, CSD may be triggered by either neurotologic or psychiatric conditions. Key diagnostic features were identified in the clinical history for each illness. F...

Drug treatment improves learning in mice with Down syndrome symptoms, Stanford/Packard study shows

... activity profile mirrored that of some well-known psychiatric medications. "This suggests that its not just the removal of the excess inhibition that allows learning to occur, but that were instead strengthening synapses through some type of long-lasting neuronal adaptation," said Garner. A key component of...

The influence of the menstrual cycle on the female brain

... important step in better comprehension of certain psychiatric and neurological pathologies. The human brain ha...ch as addictions and is also implicated in various psychiatric and neurological pathologies, such as Parkinson's disease and schizophrenic disorders. Many studies ...

New insights into autoimmunity and depression

...described a possible link between SLEs most severe psychiatric manifestation, psychosis, and a protein autoantibody associated with the central nervous system, anti-ribosomal P. To investigate how an autoantibody could stimulate behavioral changes by interaction with the brain, researchers at Tel Aviv Univer...

Cost control measures limit patient and physician choice in psychotropic medications

...ween 1996 and 2001, psychotropic drug use to treat psychiatric disorders climbed from 5.9 percent to 8.1 percent of the U.S. population. Newer, better tolerated drugs account for some of the growth; however, because they are often more expensive than more established treatments, psychotropic drug spending has sk...

Severe PTSD damages children's brains, Stanford/Packard study shows

...ficits arising from stress hormones interfere with psychiatric therapy and prolong symptoms. The children in the study were suffering from post-traumatic stress disorder, or PTSD, as a result of undergoing physical, emotional or sexual abuse, witnessing violence or experiencing lasting separation and loss. Thi...

Most first-time offenders for driving while intoxicated need help for more than just alcohol

... of other substance-use disorders as well as other psychiatric disorders. Intervention programs may need to provi... of other substance-use disorders as well as other psychiatric disorders, intervention programs may need to provide enhanced services to help this more severe subt...

New treatment possibilities for fatal genetic disease

...nts suffer from debilitating movement, memory, and psychiatric problems," he said. A/Prof Dragos discovery was made after he genetically engineered a mouse that displayed Huntingtons disease features by damaging only D1 neurons. While a mouse model that carries the human Huntington's disease gene already exi...

Drug company sales visits influenced doctors, study finds

...bel uses included treatment of pain, migraine, and psychiatric conditions. "The increased intention to prescribe after these sales visits is remarkable, and is in fact greater than has been observed in other studies," says lead author Michael A. Steinman, MD, a staff physician at the San Francisco VA Medical C...

Did drug reps encourage doctors to prescribe gabapentin for nonapproved uses?

...sed for many other conditions such as treatment of psychiatric disorders and management of pain. These researchers used the documents to research detailing and the impact it had on doctors' attitudes towards gabapentin. The documents had been produced by a market research company, which had asked doctors visit...

1 2 3 4 5 6 7 8 9 10

(Date:7/25/2014)... molecular testing panel developed at UPMC greatly increases ... for patients with thyroid nodules and cancer, report ... (UPCI), partner with UPMC CancerCenter., The test, available ... diagnostic testing agencies, improved the chances of patients ... according to the study published this month in ...
(Date:7/24/2014)... Scientists at The New York Stem Cell ... to creating a viable cell replacement therapy for ... , For the first time, NYSCF scientists generated ... samples of patients with primary progressive multiple sclerosis ... induce these stem cells into becoming oligodendrocytes, the ...
(Date:7/24/2014)... , July 24, 2014 /PRNewswire-iReach/ -- The Geneva ... from cardiac devices, has cut emergency room wait times ... San Diego (UCSD) Medical Center, according to a recent ... UCSD Emergency Departments are using the suite to access ... pacemakers or defibrillators. "Using Geneva,s technology platform ...
Breaking Biology News(10 mins):Test increases odds of correct surgery for thyroid cancer patients 2Test increases odds of correct surgery for thyroid cancer patients 3NYSCF scientists one step closer to cell therapy for multiple sclerosis patients 2UC San Diego Medical Center Cuts Average ER Wait Time by 92 Minutes using the Geneva Healthcare Suite 2UC San Diego Medical Center Cuts Average ER Wait Time by 92 Minutes using the Geneva Healthcare Suite 3
Other Tags
historyevolutionarysalamanderrewritesbrewsphysicistsmillipedescavechemoembolisationpfilegatomariannepersonalizedheaviertvsenlargement