Tag: "pump" at medical news

Novel candidate biomarker for heart failure also strongly predicts risk of death

...on in which the heart muscle is damaged and cannot pump blood efficiently, heart failure is a major cause of cardiac death. Diagnosis has been a challenge, since the symptoms of heart failure are similar to those of many other conditions. In recent years studies from several groups, including collaborat...

Exercise test may help predict mortality risk in heart failure patients

...rt failure, which is the inability of the heart to pump enough blood to keep up with the body's demands. C...h the left chamber of the heart is too weakened to pump blood efficiently. The researchers wanted to determine if the test is also appropriate for patients ...

Limiting stroke damage is focus of study

... away. Energy loss shuts down the sodium-potassium pump and the membrane that keeps the right substances i...d spine loss, and that warming of brain tissue and pump revival quickly heals old spines and induces new ones. Now he wants to know if the new spines funct...

UPMC begins study of heart support device as a bridge to transplantation

...ine. The VentrAssist LVAD is a mechanical blood pump that is implanted in the body to assist the heart to pump blood around the body for people with end-stage heart failure. It is still an experimental investiga...

UCLA imaging study reveals how pure oxygen harms the brain

...se chemicals interfere with the heart's ability to pump blood and deliver oxygen the opposite effect you want when you're trying to resuscitate someone." When the children inhaled the carbon dioxide-oxygen mix, the hypothalamus' hyperactivity vanished from the MRI scan. "Adding carbon dioxide to th...

One pill may be better than two for treating patients with high blood pressure

... blood in the arteries when the heart contracts to pump blood to the body. Diastolic pressure is the forc...ng the blood vessels so the heart does not have to pump as hard. Atorvastatin (brand name Lipitor) is in a class of medications known as statins or HMG-CoA ...

Experts debate role of stenting, bypass surgery in left main coronary artery disease

...de effects are common following the use of a heart pump to circulate blood during surgery, for example. Equally important, a large percentage of bypass grafts become narrowed with plaque build-up within five years of surgery. "In a prospective trial with hard endpoints of death and heart attack, I think w...

Percutaneous aortic valve replacement safe, successful in high-risk patients

...he procedure, the patients were placed on a bypass pump for an average of 3040 minutes to minimize blood flow through the aorta and ease placement of the replacement valve. All 17 patients survived the procedure. One patient died 5 days later from stroke. Five additional patients died after discharge f...

Discovery of cellular processes which regulate heart's energy supply

...e heart requires to produce the energy it needs to pump effectively. "Nuclear receptors receive signals from different parts of the body," explains Dr. Gigure's. "These signals "tell" the cell what action to take by controlling which genetic program will be turned on or off in the cell. Because the ERR...

Machine preservation may promote more organ sharing

...eserving the kidneys of deceased older donors on a pump as opposed to the conventional method of storing ...lege of Surgeons. In addition, Stratta said, the pump can be used to project the kidneys initial function allowing for more appropriate matching of donor...

Increasing survival of organ transplant patients by reducing time interval for transported organs

... Sessions today explores two diverging systems for pump preservation the Organ Care System (OCS) and the cold preservation method, and how they each effect survival for heart transplant patients. The cold preservation method, which has been in practice for more than 25 years, delivers the organ in a no...

Implant device effectively maintains heart function for transplant-listed patients

... the performance of this new continuous flow blood pump technology, of which the HeartMate II is the first...failure is a condition in which the heart fails to pump adequate amounts of blood to the tissues to sustain normal bodily functions. While primarily caused...

Drug/intervention combinations offer benefit in severe CVD

...nic shock is diagnosed when the heart's ability to pump is markedly reduced, causing a "shock-like" state; the condition often occurs as a result of AMI. Studies have shown that overproduction of nitric oxide after a heart attack may play a significant role in the development and persistence of CS, and r...

Biologists learn structure of enzyme needed to power 'molecular motor'

...le-stranded DNA, this ATPase uses the mechanism to pump genetic material into the virus capsid," Sun said. The researchers determined the enzyme structure using a technique called X-ray crystallography. This technique involves crystallizing a substance like the ATPase and then passing X-rays through the...

Sleep apnea common, but undiagnosed, among pacemaker patients

...ure, which means that the heart cannot efficiently pump blood. Thirty-three patients had a high degree atrioventricular block or AV block, which is a blocked electrical signal from the hearts upper chamber (atria) to the pumping chamber (ventricle). Thirty-six had sinus node disease, in which a heart c...

Depression increases health risks in heart failure patients

...hypertension, and even the ability of the heart to pump blood throughout the body. After taking into acc... is marked by the inability of the heart muscle to pump enough oxygen and nutrients in the blood to the bodys tissues. A variety of factors can cause heart ...

46-year-old man receives first temporary total artificial heart in Northeast US from Penn

...ior to the surgery, Onufer's heart could no longer pump enough blood to sustain his body, damaging his vital organs. Morris comments, "This unique new cardiac technology keeps the sickest of the sick - those with damage to their entire heart muscle -- alive while they wait for a heart transplant. This ...

Study tests oral insulin to prevent type 1 diabetes

...ulin injections a day or treatment with an insulin pump to maintain blood glucose control. To prevent complications, they must regularly monitor their blood glucose, striving for a range that is as close to normal as possible. The constant challenge of managing the disease poses an enormous burden on pa...

University Hospitals Case Medical Center researcher awarded

...d will help him research whether an under-the-skin pump is as effective as an intravenous drip in treating patients with neurological diseases with immune globulin. Immune globulin replaces missing antibodies in people with PID, but high doses are used to fight autoimmune diseases such as myasthenia grav...

Study demonstrates long-term durability of Plicator procedure

... symptoms without the need for prescription proton pump inhibitors and only rare use of antacids according...the 29 patients in the study required daily proton pump therapy prior to the procedure. The other patient was on high dose histamine 2 antagonist therapy. ...

1 2 3 4 5 6 7 8

(Date:6/17/2013)... CORVALLIS, Ore. Amphibian populations are declining worldwide and ... be spread by bullfrogs, but a two-year study shows ... suggestions that bullfrogs are a tolerant carrier host that ... frogs from eggs in controlled experimental conditions, they found ... dendrobatidis , also called Bd or a chytrid fungus, ...
(Date:6/16/2013)... prevention programs for female sex workers in India reduce ... (STIs), a University of Toronto study has found. ... HIV, mostly in the southern states of Andhra Pradesh, ... Professor Prabhat Jha from U of T,s Dalla Lana ... for Global Health Research (CGHR), examined the impact of ...
(Date:6/16/2013)... ago triggered a similar marine ecosystem crisis to those ... warming, according to research published today in Nature ... universities of Newcastle, UK, Cologne, Frankfurt and GEOMAR-Kiel, confirms ... the marine ecosystem during the mid-Cretaceous greenhouse period. ... amplitude and duration of the temperature change.,Analysing the geochemistry ...
Breaking Biology News(10 mins):Bullfrogs may help spread deadly amphibian fungus, but also die from it 2HIV prevention among female sex workers in India reduces HIV and syphilis 2Global cooling as significant as global warming 2
Other Tags
comparablemarimastatketektenthdarklyairwayeditsfluorideappropriationsconveysasmusualunprovengambiaopposeshivma