Tag: "quarter" at medical news

Preemies defy odds and overcome difficulties by adulthood: Study

... for the infants and their parents, as more than a quarter of low birth weight children have development difficulties such as cerebral palsy, blindness and delayed development, compared to two per cent of normal birth-weight infants. Dr. Saroj Saigal, professor of pediatrics, conducted a study over two years...

Drug aimed at Huntington's eases chorea, the disease's hallmark feature

...ir caregivers to adjust the dosage safely. About a quarter of patients reported sedation, fewer than 10 percent of patients had motor restlessness, and fewer than 5 percent had motor slowing or depressed mood. Side effects generally resolved with downward adjustment of the dosage. Of concern, one patient com...

Let patients use their own terms to describe ethnicity

...scription method they preferred. Overall, about a quarter of participants strongly preferred using their own words to describe themselves using a single term, for example, white, black or African American; Hispanic or Latino. Among the Latino/Hispanic and multiracial/multiethnic study participants, a major...

MRSA in Sweden: A quarter of cases infected abroad

A quarter of all people with MRSA in Sweden between 2000 and 2003 were infected abroad. A study published today in the open access journal BMC Infectious Diseases reveals that the number of methicillin-resistant Staphylococcus aureus (MRSA) infections in Swede...

Latest research shows how mantrams can even tackle post-traumatic stress disorder

...ay - useful on a number of occasions. Just under a quarter of these occasions (24 per cent) related to traffic and work-related stress, 13 per cent to insomnia and 12 per cent to unwanted thoughts. More than half (51 per cent) related to emotional situations. "Repeating the mantram seemed to stop post-tr...

Acrux patent portfolio advances in USA

...ith results expected to be available in the second quarter of 2006. The new patent does not expire until 31 July 2022, which is five years later than Acrux's other granted US patents. Acrux CEO Igor Gonda commented "This new patent provides very broad protection for the familiar part of our products that the...

Preparation needed as children enter schools already overweight

...The Journal of School Health finds that nearly one quarter of children, ages three to five years, were entering school in Chicago overweight. For the authors, this is an urgent problem reflecting the nutritional status and health influence of the children's home and community. The results signify a need fo...

Cognitive impairment appears to be common in ALS patients

...LS demonstrated cognitive impairment, and nearly a quarter qualified for a neuropsychologic diagnosis of dementia," the authors write. "Free recall, executive function and naming were most impaired in ALS patients with dementia." Future studies using testing and diagnostic criteria specific to frontotempor...

AACR supports the nomination of Andrew von Eschenbach as the commissioner of the FDA

...Anderson Cancer Center. Dr. von Eschenbach spent a quarter of a century there, moving from faculty member to department chair to executive vice president and chief academic officer. Subsequently, Dr. von Eschenbach was named Director of the National Cancer Institute, the 12th person to assume this responsibi...

Vanderbilt-Ingram Cancer Center researchers find ginseng may improve breast cancer outcomes

...and material well-being. Before diagnosis, about a quarter of patients (27.4 percent) reported using ginseng regularly. After diagnosis, that percentage jumped to 62.8 percent, the researchers found. They also found significant improvements in both survival and quality of life measures in patients who used g...

Kids with cavities overweight, not underweight

...ildren's Hospital of Buffalo found that at least a quarter of the patients were over the recommended weight for their age or close to it, unlike their peers who had good teeth. Results of the research were presented at the International Association of Dental Research meeting held March 9-12 in Orlando, Fla....

Exercise reduces menopausal symptoms and improves quality of life

...umber of women suffering severe symptoms fell by a quarter after they took part in a 12-month supervised exercise programme, while problems increased among women who didn't exercise. Fifty per cent of the 24-strong exercise group had severe symptoms at the start of the programme compared with 37 per cent at ...

Male smokers 40 percent more likely to be impotent than non-smokers

...th or more during the preceding year. More than a quarter of the respondents were smokers, one in five of whom smoked 20 or fewer cigarettes a day. Just over 6% smoked 20 or more a day. The results pointed to a significant association between smoking and erectile problems, which became stronger with increas...

Teens' herbal product use associated with illicit substance use

...3 in the Journal of Adolescent Health. More than a quarter of the Monroe County high school students in the sample reported having ever used herbal remedies and of those, the heaviest herbal users were more likely to use illicit drugs. Teen responders decided for themselves what would be considered "herbal o...

Young patients more likely to die in countries where health care is funded by private insurance

... survival amongst 15 to 29-year-olds over the last quarter of a century is striking and there are reasons that are common between different countries. These include the tendency for adolescents and young adults to wait longer before consulting a doctor about symptoms, lack of a regular and usual source of p...

80 percent of vasectomy patients didn't complete all-clear semen tests

A quarter of the men who had vasectomies at a US clinic didn...nt that did attend their first, eight-week test, a quarter provided samples that still contained sperm. 80 of the 83 men were producing nonmotile (present but ...

Cinnamon, cloves improve insulin function, lower risk factors for diabetes, cardiovascular disease

...of Agriculture, had shown that the equivalent of a quarter to half a teaspoon of cinnamon given to humans twice a day decreased risk factors for diabetes and cardiovascular disease, including glucose, cholesterol and triglycerides, by 10 to 30 percent. These new studies showing cinnamon's ability to block i...

Spirited study aims to help older Australians

...Australians will leap from 12 per cent to almost a quarter of the population. Tending their spiritual needs will be just as important as maintaining their physical health," she says. "Pastoral care is often considered a low priority in Australia, largely because the benefit to individuals is not well underst...

Gender equality leads to better sex lives among people 40 and over

...l lives. In East Asian countries, only about one quarter of men and women reported physical and emotional pleasure with sex, while two thirds of the men and half of the women reported satisfaction with their ability to have sex. Among men, 28 percent said sex was important to them, while only 12 percent of...

Look out! Eyeglass injuries may lead to hospital visit

... the working-age group, accounting for just over a quarter (26.7 percent) of the injuries in this group. Sports and recreation activities were the greatest sources of glasses-related injuries in children, and caused 36.6 percent of eye injuries in this group. Lacerations, or cuts, to the face, head or eyeba...

1 2 3 4 5 6 7 8

(Date:5/17/2013)... Shenzhen, China---- Why Tibetan antelope can live at ... a collaborative research published in Nature Communications ... institutes provide evidence that some genetic factors may ... highland environments. The data in this work will ... and the biology of other ruminant species. , ...
(Date:5/17/2013)... team of scientists using a new X-ray method recorded ... frog embryo in greater detail than ever before., This ... and the search for new treatments for genetic diseases., ... Technologie in Germany, in collaboration with the Advanced Photon ... Laboratory, released the most precise depiction ever of the ...
(Date:5/16/2013)... fast food restaurant had a higher body mass index ... food, according to researchers at The University of Texas ... strong among those with a lower income. , ... Journal of Public Health indicates higher BMI associates ... among lower-income African-Americans, the density, or number, of fast ...
Breaking Biology News(10 mins):The genome sequence of Tibetan antelope sheds new light on high-altitude adaptation 2New X-ray method shows how frog embryos could help thwart disease 2Body mass index of low income African-Americans linked to proximity of fast food restaurants 2Body mass index of low income African-Americans linked to proximity of fast food restaurants 3
Other Tags
naturetoldentrepreneursrepellentsfiringmixesriboswitchespeekscryingnighttimechronicinfantsmaasiowacabonathan