Tag: "resistant" at medical news

Community MRSA is re-emergence of 1950's pandemic

... - infections picked up in public places which are resistant to treatment by powerful meticillin antibiotics - may have evolved from this earlier pandemic-causing strain. The researchers have sequenced key genes from 80/81 samples isolated between 1955 and 1969 in Australia, England and the USA, and compared t...

American Thoracic Society Journal news tips for April 2005 (first issue)

...; however, soon many patients developed antibiotic resistant strains and little ultimate benefit came to those treated. The next big movement forward came with the introduction of a combination of drugs, including streptomycin, to prevent the emergence of drug-resistant Mycobacterium tuberculosis. By 1955, c...

Exercise may not be good enough to reduce mild hypertension in older people, Hopkins experts say

... diastolic blood pressure, and older people may be resistant to reducing their systolic blood pressure even though they made substantial gains in fitness with exercise training, he adds. Upon closer examination, the Hopkins team found that people most likely to decrease both systolic and diastolic blood pressu...

Nanotechnology's miniature answers to developing world's biggest problems

...cular structures to make asphalt and concrete more resistant to water; materials to block ultraviolet and infrared radiation; materials for cheaper and durable housing, surfaces, coatings, glues, concrete, and heat and light exclusion; and self-cleaning for windows, mirrors and toilets. 9. Health monitoring: s...

Late-breaking science presented at 57th AAN Annual Meeting

...astrophic form of childhood epilepsy that is often resistant to treatment with conventional anti-seizure medications. In this trial, 138 patients with treatment-resistant LGS received either the novel drug rufinamide or placebo for 12 weeks. Rufinamide reduced monthly seizure frequency by 33 percent, compared ...

Gene expression pattern predicts multiple drug resistance, treatment failure in pediatric leukemia

...ype of drug resistance in which leukemic cells are resistant to asparaginase (ASP) but sensitive to vincristine (VCR). This "discordant" type of resistance (resistance to one drug and sensitivity to another) was associated with a poor response in children who had this pattern of gene expression. Cross-resista...

CML found to wield 'death factor' that kills normal blood marrow cells

...s platelets, but leukemia cells are believed to be resistant to the effects of 24p3, the researchers found. "This provides an understanding of how Philadelphia chromosome-positive cells can overcome and grow effectively in a crowded marrow environment," Arlinghaus says. "The disease may begin with a single tra...

Increasing benefit seen in novel drug that treats Gleevec resistance

...l drug is producing powerful responses in patients resistant to Gleevec, the targeted therapy that helps most people diagnosed with chronic myeloid leukemia (CML), an international research team headed by investigators at The University of Texas M. D. Anderson Cancer Center is reporting. The drug, AMN107, is s...

Short sugar chains-a future drug for Alzheimer's?

... heparanase-producing mice proved to be completely resistant to amyloidosis of the liver and kidneys, organs with pronounced overproduction of the enzyme and therefore very short heparansulfate fragments. On the other hand, they did develop amyloid in the spleen, which had avoided overproduction of heparanase ...

Propensity for obesity, diabetes, may occur in utero

...ogramming could be interrupted if an obese/insulin resistant mother brought body weight and plasma insulin levels back to normal before becoming pregnant. Malathi Srinivasan. Ph.D, Suhad Shbeir-ElDika, Ravikumar Aalinkeel, Ph.D., Fei Song, Ph.D., Lioudmila Pliss, Ph.D., and Paul Mitrani from Patel's lab, alo...

Anti-malaria drug combination could help address treatment crisis in Africa

... severe form of malaria, Plasmodium falciparum, is resistant to the anti-malaria drug chloroquine in nearly all the areas where the disease is rife. This, along with the fact that resistance to sulfadoxine-pyrimethamine is spreading rapidly, has led to strong calls for the introduction of combination treatment...

Reducing malarial transmission in Africa

...lopment of resistance and minimize transmission of resistant parasites. In this month's premier open-access jou...ommunity it might reduce selective transmission of resistant parasites in treated patients....

Milk thistle does not reduce deaths from liver diseases, best studies find

...cleared in a handful of patients, many strains are resistant to treatment. Drug therapies that focus on long-term suppression of the virus are expensive, and many patients develop a resistance. The current gold standard treatment, which combines injections of interferon and ribavirin, has serious side effects...

Giving children access to drug clinical trials is crucial, clofarabine approval shows

...eloid leukemia (AML), which is generally more drug resistant than ALL." The FDA used its accelerated approval process for clofarabine based on results of a multicenter Phase II trial, the authors said. In the trial, 31 percent of 49 patients with ALL responded to the drug, with six of these children achieving...

UT Southwestern researchers show new drug may help treat certain forms of leukemia

...ay be effective against a certain form of leukemia resistant to current treatments, research at UT Southwestern... to 20 percent of patients who take Gleevec become resistant to the drug and relapse, leaving few effective treatment options. In the Blood study, Dr. Ilaria and...

Medication or psychotherapy effective in treating depressed patients when the other is not

...o background information in the article. For those resistant to treatment there are several options available, including switching medication, enhancing or combining medications, and switching to or enhancing treatment with psychotherapy. Alan F. Schatzberg, M.D., from Stanford University School of Medicine, ...

Stroke drug still meets resistance from doctors wary of its risks

... wouldn't give tPA, 65 percent of the reluctant or resistant physicians cited the concern over hemorrhage, 23 percent said they didn't perceive that the drug would provide benefit, and 12 percent gave both reasons. In all, the physicians set an average upper limit of 3.4 percent intracranial hemorrhage risk a...

Two studies document rise of superbugs in the environment

...'t bad enough, some bacteria have become multidrug resistant (MDR). Researchers at the Beth Israel Deaconess Me... Medical School studied the prevalence of bacteria resistant to three or more drugs over a six-year period. From 1998 to 2003, there was a significant increase ...

Sensor warns of gastrointestinal problems

...rtion measurement on a home trainer. The sensor is resistant to hydrochloric acid because in both cases it will remain in the stomach for some time. For the measurements, Herber is developing a prototype catheter in cooperation with Sentron Europe BV. They want to produce the sensor, if the measurements prove ...

Study: Americans willing to pay more for greater vaccine coverage

...t few years, some health insurance plans have been resistant to cover them. This trend has left about 15 percent of privately insured children (about 5 million) and as many as 30 percent of privately insured adults (about 36 million) underinsured for new vaccines, and may contribute to immunization rates that ...

1 2 3 4 5 6 7 8 9 10

(Date:5/21/2013)... battle? Try staying fit in space, where living quarters ... , That,s the challenge a group of Michigan State ... million grant from NASA. Their goal is to keep ... "You could give astronauts the best exercise regimen there ... to it, it isn,t going to help," said project ...
(Date:5/21/2013)... biomass experts , Where? Copenhagen, Denmark: ... 03-07 June 2013 , Why? ... market and policy developments, manufacturing and installation, drawing on ... from its 2013 edition from a record of more ... more than 240 plenary and oral presentations, more than ...
(Date:5/21/2013)... The epigenetic modifications, which alter the way genes ... apparently be detected in the blood of pregnant ... way to foretell depression in the weeks after ... symptoms become debilitating. , The findings of the ... online in the journal Molecular Psychiatry . ...
Breaking Biology News(10 mins):Fueling fitness on the final frontier 221st European Biomass Conference and Exhibition 221st European Biomass Conference and Exhibition 321st European Biomass Conference and Exhibition 4Genetic predictors of postpartum depression uncovered by Hopkins researchers 2Genetic predictors of postpartum depression uncovered by Hopkins researchers 3
Other Tags
deficitmammarymissilesguidedcoloradoinfluencesculturealoneopensdocumentedruinousmethamphtetamineflycheckfacedmetacognition