Tag: "sensitive" at medical news

Autistic children's abnormal metabolic profile findings

... free radicals. Unopposed free radicals can damage sensitive cells in the brain, the gastrointestinal tract, and the immune system, and the researchers believe they may contribute to the neurological, gastrointestinal and immunologic pathology that occurs in autistic children. Working with a larger number of a...

Pediatricians must confront community-based threats to health

...y of health care. Pediatricians are becoming more sensitive to the direct relationship between socioeconomic status and child health. Economically disadvantaged youths are more susceptible to teen pregnancy, violence and injury, sexually transmitted diseases, and mental health problems. Racial and economic d...

Maternal iron deficiency disrupts mother/child interaction

...tions, the mildly iron-deficient mothers were less sensitive to their baby's cues. They also scored lower on giving their babies chances to lead interactions. In addition, the iron-deficient mothers cut in on the baby's play at inappropriate times more often and appeared bored or distant more frequently than...

2005 Potamkin Prize goes to neurologists for research in early detection of Alzheimer's disease

... incipient Alzheimer's disease. After establishing sensitive methods to distinguish Alzheimer's, he went on to ...apies, and have stimulated an intensive search for sensitive predictive biomarkers of AD." Petersen's research has focused on mild cognitive impairment (MCI). "T...

Painless test using teardrops may speed diagnosis of Sjgren's syndrome

...tiple protein biomarkers in the tears using highly sensitive mass spectrometry, shows promise in early clinical studies as the first simple test for identifying the disease, the scientists say. Sjgrens affects between 1 million and 4 million Americans, primarily women over age 40. April is Sjgrens Syndrome Awa...

Blood test can accurately diagnose heart failure in emergency patients

...sults came from combining the results of this very sensitive and specific blood test with the logic and wisdom of a good emergency physician, which gave the optimal balance between biologic data and clinical judgement." Congestive heart failure, which occurs when an impaired heart muscle cannot pump blood effi...

Obesity and insomnia linked by excitability of brain cells

...us region of the brain that are easily excited and sensitive to stress, Yale School of Medicine researchers report in the April issue of Cell Metabolism . "If these neurons are over-activated by environmental or mental stress in daily situations, they may support sustained arousal, triggering sleeplessnes...

News tips from the Journal of Neuroscience

...aldwell Dopamine neurons appear to be particularly sensitive to cellular stress caused by protein misfolding or oxidative damage. For example, mutant or overexpressed a synuclein causes intracellular inclusions (Lewy bodies) and cell degeneration of dopamine neurons. Such mechanisms are considered central to t...

Doing a spin with DNA

... broken ends back together again. With the help of sensitive measuring devices, the researchers could measure various parameters such as the friction of the rotating DNA in a cavity of the enzyme. The research has provided new insights into the interactions between DNA and the enzyme, which are of fundamental ...

Bright arctic light can lead to migraine

...wo percent of the women with aura became extremely sensitive to light during and between attacks, compared to 41 percent of those without aura. Those with migraine with aura were also more likely to wear sunglasses to prevent attacks. There were no differences between the two groups in sleep cycles, sleep dist...

Shape-altering genes linked to ovarian cancer

...sive than high-grade tumors. Because HOX genes are sensitive to levels of the female hormones estrogen and progesterone produced in the reproductive organs, Naora speculates that abnormal changes in levels of these hormones could explain how the HOX genes come to be turned on in ovarian tissue. Indeed, most of...

NCI's Patient Navigator Research Program: Questions and answers

...ifying and scheduling appointments with culturally sensitive caregivers; coordinating care among providers (such as screening clinics, diagnosis centers, and treatment facilities); arranging for translation/interpretation services; ensuring coordination of services among medical personnel; ensuring that medica...

Gene expression pattern predicts multiple drug resistance, treatment failure in pediatric leukemia

...emic cells are resistant to asparaginase (ASP) but sensitive to vincristine (VCR). This "discordant" type of re...56 percent among patients whose ALL cells were VCR sensitive and ASP resistant. The genes linked to discordant resistance included many that are involved with th...

Mercury levels and cognitive function investigated in adults

...key point is that the aging population may be more sensitive to toxic chemicals and this is the first study to examine mercury exposure in the older U.S. population," said Megan Weil, MHS, lead author of the study and a PhD-candidate in the Bloomberg School of Public Health's Department of Environmental Health...

No strong evidence linking mercury levels with worse neurobehavioral performance in older adults

...er disease. Since the aging nervous system is more sensitive to neurotoxicants, there is reason for concern abo...t to examine whether this rapidly growing group is sensitive to even lower levels of exposure. Since the blood mercury levels in our study did not appear to be a...

'Virtual colonoscopy' effective in finding most polyps but may miss small ones

...st large colorectal polyps and masses, but is less sensitive for detecting smaller polyps," the review concludes. Other findings: There is no direct evidence as to the effect of any method of screening on the prevention of colon cancer incidence or death. Virtual colonoscopy is safer, although traditional ...

Jefferson Lab scientists build small-animal imager for German Cancer Research Center

...e built it with a new type of flat panel, position sensitive photomultiplier tube," he explained. The effort to develop international collaborations such as this one began a few years ago when Detector Group leader Stan Majewski tasked Mark Smith with finding potential scientific partners in Europe, to provide...

New portable device developed by Georgia Tech and Emory checks for concussions on the sidelines

...tem), the device is a fast, easy to administer and sensitive system for assessing problems associated with concussions. The DETECT device is an integrated system that includes software applications, a portable computer and an LCD display in the headgear. While a typical mTBI test requires a quiet room and 1-2...

Managed care organizations evaluate trends in epilepsy to provide better care

...lgorithms developed for this study were especially sensitive to determine epilepsy prevalence, incidence and mortality in an MCO population, helping administrators to develop and focus interventions and assess the impact of quality-improvement programs. The best model correctly classified 90% of the cases in ...

Color doppler sonography speeds detection of serious illness in premature infants

...les. The study results indicated that CDS was more sensitive and specific than x-ray for determining NEC in newborns. "It's a very simple idea," Dr. Faingold said. "If there is blood flow to the wall of the intestine, that's a good sign. If there is no blood flow, that's bad. It means that particular area of ...

1 2 3 4 5 6 7 8 9 10

(Date:5/16/2013)... to Research Careers) Program has announced the travel ... Annual Meeting in San Francisco, CA from June ... the entry of students, postdoctorates and scientists from ... science community and to encourage the participation of ... , Awards are given to poster/platform presenters and ...
(Date:5/16/2013)... ancient shorelines to predict the stability of today,s largest ice ... from three million years ago, for example when Earth ... be evidence of a high sea level due to ice ... scientists to think that if the world,s largest ice sheets ... same in our modern, progressively warming world. , However, ...
(Date:5/16/2013)... cellular layer lining the body,s blood vessels, is ... in thickness, this super-tenuous structure routinely withstands blood ... create a unique and highly dynamic barrier that ... the body,s circulatory system. , It,s also extremely ... physically breached to enable immune cells to ...
Breaking Biology News(10 mins):World's biggest ice sheets likely more stable than previously believed 2Endothelium, heal thyself 2Endothelium, heal thyself 3Endothelium, heal thyself 4
Other Tags
manageradoptionhysteriagrapplingbrewsphysicistsmillipedescavemassesremovingcompletelyappropriatewiperelativelycursorsmalarial