Tag: "sound" at medical news

Whooping cough persistence traced to key toxin

...e spells of coughing and a characteristic whooping sound while inhaling. Though the widespread use of vaccines has helped reduce disease drastically, recent surveys reveal that the disease is increasingly being diagnosed in a large number of vaccinated adults, posing a serious health risk to unvaccinated c...

UCI wins $2.4 million grant to study how brain understands language

... to unlock the secrets of how the brain translates sound waves into meaningful language. Greg Hickok, prof...ng more than tiny fluctuations in air pressure, or sound waves," Hickok said. "The ability of humans to turn these sound waves into meaningful language is a ...

Role of nervous system in fatal heart rhythm under study

...y abnormal rhythms, and echocardiograms, which use sound waves to create a moving picture of the heart, haven't been able to pinpoint minute changes that are a precursor to ventricular fibrillation; they only provide a picture of large scale electrical activity. But, by using voltage-sensitive fluorescent ...

NCI issues clinical announcement for preferred method of treatment for advanced ovarian cancer

...tutes of Health--for unbiased research studies and sound counsel. This clinical announcement is a demonstration of that commitment," said NIH Director Elias A. Zerhouni, M.D. "The National Cancer Institute wants to make certain that the results of clinical research are rapidly disseminated to both health c...

Abstinence is healthy goal for teenagers but research critiques abstinence-only educational policies

...t efforts to promote abstinence should be based on sound science. Drawing a distinction between abstinence as a behavior and abstinence-only programs, the paper concludes there is no evidence base for providing "abstinence only" or "abstinence until marriage" messages as a sole option for teenagers. In r...

Morning grogginess more debilitating than sleep deprivation, according to CU-Boulder study

... shows that people who awaken after eight hours of sound sleep have more impaired thinking and memory skills than they do after being deprived of sleep for more than 24 hours. The study showed test subjects had diminished short-term memory, counting skills and cognitive abilities during the groggy period u...

MRIs better at diagnosing needs for 'bionic ear' implants

... ear, Dr. Roland said. The ear normally translates sound waves a mechanical form of energy to electrical ...rocess than hearing aids, which simply amplify the sound waves. Cochlear implantation is targeted to those with nerve deafness, which patients can be born wi...

Flu not the only germ threat this time of year

...effective ways to transmit disease." While RSV may sound new, the best way to prevent it washing your hands is not. "We've known for more than 100 years that hand washing prevents infection, but we still can't get people to wash their hands," said Falsey. "Hand washing is the simplest, most effective way...

Norwegian government handles research fraud

...themselves have a special responsibility to create sound systems to prevent fraud. The hospital has established an external investigating committee headed by Professor Anders Ekbom of Karolinska Institutet in Stockholm. Other members of the committee include Dag Thelle from the University of Oslo and repre...

Researchers develop portable 'vein finder' for faster, more accurate injections

... a phenomenon that occurs when electromagnetic and sound waves interact with a moving object, altering wave...de. The needle guide is positioned parallel to the sound beam being transmitted by a transducer in the device's reusable section. As medics move the device ...

Nursing professor calls for steps to close the reality gap between education and practice

...rkforce is resolved, the gap between theoretically sound practice and actual care delivery will remain with us" she says. "Students should be exposed to extensive simulated learning opportunities. This would, at a stroke, reduce some of the pressures on practising nurses. "As a profession we should be de...

Repetition reverses med students' stethoscope shortcomings

..." In previous studies, the rate of accurate heart sound identification ranged from 20 percent of medical students to fewer than 40 percent of internists. Traditional teaching methods for stethoscope skills -- classroom lectures -- have proven inadequate. "We hypothesized that cardiac auscultation is mo...

Trauma-center care significantly lowers risk of death

...rs with crucial information, so that they can make sound decisions regarding their trauma systems and the care that people receive after they are injured. It is one way that the Centers for Disease Control contributes to reducing premature death and disability through research and partnerships," said Richa...

$5.4 million grant to Yale EPH to study parasitic disease spread by female sand flies

...ve that the current study in Colombia can become a sound epidemiological model for other endemic regions."...

JRRD special issue on hearing and hearing loss

...r clinical practice. Bilateral amplification and sound localization , pg 117 The history, recent research... Because of the advantages of two hearing aids for sound localization and speech intelligibility, hearing aid candidates prefer bilateral fittings. Speech ...

Chance, music, and the ear of the beholder

...to be especially sensitive to degrees of change in sound that the brain is most likely to encounter in the ... that change more abruptly than the 1/f rule would sound unpleasantly erratic. In contrast, melodies that change more slowly sound boring. Now, in the new st...

Sound nutrition for children is an unmet human right

...propriate action in all areas." "Good nutrition, sound nutrition it's not just a good idea, it's a right," challenges Webb, the former chief of nutrition for the UN World Food Programme. "It's a human right. And it's as yet an unmet right."...

Baby got math

...Max Planck Society, presented the monkeys with the sound of two or three animals making a natural "coo" sou...the sounds successively and so the duration of the sound sequence was a potential problem." Finally, said Brannon, previous experiments used the same subject...

Brain processing of speech sounds is different in some southern English speakers

...es and Texas, where a merged-dialect speaker might sound like they're pronouncing both "pin" and "pen" as "pin" to an unmerged-dialect speaker. The merged-dialect speaker is unlikely to be aware of the lack of distinction between the two sounds. "Our study was interested in figuring out what happens in the...

Rheumatoid arthritis does not increase risk of hearing loss, Mayo Clinic study finds

...id arthritis had abnormal hearing for at least one sound frequency (a measure of pitch), as did 14 of 30 of those without rheumatoid arthritis. Dr. Matteson notes, however, that the findings do not mean that hearing loss is never related to rheumatoid arthritis. "Hearing loss can be a symptom of rheumato...

1 2 3 4 5 6 7 8 9

(Date:5/16/2013)... MA -- Injectable nanoparticles developed at MIT may ... 1 diabetes to constantly monitor their blood-sugar levels ... were designed to sense glucose levels in the ... of insulin, thereby replacing the function of pancreatic ... Type 1 diabetes. Ultimately, this type of system ...
(Date:5/16/2013)... so many sports players and athletes choose to wear ... to be published in Psychological Science , a ... it may have to do with their testosterone levels. ... Farrelly of the University of Sunderland and colleagues, demonstrated ... a competitive task had higher testosterone levels than other ...
(Date:5/16/2013)... years old give unprecedented insight into the evolutionary ... most species-rich groups among the modern bony fishes. ... from the Division of Paleontology and Geobiology at ... Ludwig-Maximilians-Universitaet (LMU) in Munich / Germany have completed ... assign to the group of bony fishes that ...
Breaking Biology News(10 mins):Nanotechnology could help fight diabetes 2Nanotechnology could help fight diabetes 3High-testosterone competitors more likely to choose red 2Paleontology: The eloquence of the otoliths 2Paleontology: The eloquence of the otoliths 3
Other Tags
naturetoldentrepreneursrepellentsfiringmixesriboswitchespeekscryingnighttimechronicinfantsmaasiowacabonathan