Tag: "suffered" at medical news

New family of biodegradable polymers shows promise for intracellular drug delivery

...ts to treat acute liver failure in people who have suffered an alcohol or acetaminophen overdose. In these patients, the liver stops functioning because macrophage cells in the liver create reactive oxygen species. One of the treatments is the delivery of superoxide dismutase, an enzyme that essentially detox...

Method for avoiding sudden death

... 4 years of IAD implants, 80% of the patients have suffered a crisis. The IAD does not interfere with their daily lives but, above all, they stay alive. The number of persons who have been saved from certain death is the same as the number of devices implanted. In the last few years a new type defibrillator...

Grieving parents at increased suicide risk

...ompanying editorial describes the immense distress suffered by parents caring for dying children. Once the child has died, many child cancer units provide bereavement support for families, with surveys suggesting this is generally to a high standard. But there is very little guidance or research on how healt...

Blood transfusions linked to increased mortality in patients suffering from cardiac episodes

... is common practice for patients who have recently suffered from myocardial infarction, or heartattacks. Study authors from the Cleveland Clinic Foundation in Ohio researched the death rate of heart attack patients who received blood transfusions and found that these transfusions are associated with a marked...

Enoxaparin beats unfractionated heparin as adjunct therapy for heart attacks

...egy that prevents blood clots in patients who have suffered a heart attack markedly reduces the risk of repeat heart attack or death when compared to an older, more widely used blood thinning strategy, according to a large international study presented today at the American College of Cardiology's 55th Annual...

Complex artery disease best treated with simple approach

...ronary events (MACE if some of the patients died, suffered from a heart attack, needed re-treatment or had a clogging of the artery) to determine which strategy would provide the best outcome. A total of 413 patients with extensive cardiac artery disease were randomized in a multi-center study conducted by t...

Could a simple test save Medicare hundreds of millions?

...st of medical care for those who stayed healthy or suffered a heart problem with or without an ICD. To account for the uncertainties inherent in each of the clinical variables, the researchers performed various levels of sensitivity analyses, including an analysis using 10,000 simulations in which all model ...

Heart devices, procedures evaluated across patient populations

...ge. Only one of the six athletes under age 30 who suffered from SCD received defibrillation at the scene and, consequently, survived to hospital discharge. Two additional patients were resuscitated during hospital transport, leading to a total survival rate of 50 percent for patients under age 30. "Our st...

Lumbee Native Americans have higher cardiovascular risks

... as non-Lumbees, yet they were more likely to have suffered from at least one non-fatal heart attack during that time. The Lumbees also had lower rates of heart procedures whether angioplasty or coronary artery bypass surgery to re-open clogged coronary arteries during that nine-year period. The researchers...

Genetic perversity: Smoking & gene avert Parkinson's

.... He warned that there were still many smokers who suffered from Parkinson's. Additionally, smoking was notorious for causing cancers. Parkinson's disease is a common degenerative neurological disease in the elderly, affecting up to 4.9 percent Australians aged 55 and over. "Our study findings aid in further ...

The dual functions of sight perception and action demonstrated for first time

... the beginning of the 20th century in patients who suffered damage to the visual system as a result of illness or injuries in which one or the other function identification or action was damaged. For example, persons suffering from ataxia are able to verbally identify an object presented to them but have ...

Penn pairs chronically ill patients with medical students to create better doctors

...Becker eventually lost her oldest sister, who also suffered from the disease. And throughout Becker's life, as a single parent, she has been in and out of the hospital often. But she persevered, "You put one foot in front of the other and do what you need to do." On oxygen round the clock, Becker, a Shiloh, N...

Latest research shows how mantrams can even tackle post-traumatic stress disorder

...been diagnosed with a psychiatric disorder and six suffered from post-traumatic stress disorder. 31 of the 36 hospital staff were female with an average age of 50 and two had a psychiatric diagnosis. "Mantram repetition may be useful in diverse modern populations for managing a variety of internal emotional s...

Acupuncture is as effective as standard drug treatments for migraine

... showed that the number of days on which a patient suffered from migraine was significantly reduced after treatment with either acupuncture or standard therapy. However, the improvement was the same whether the patient was treated with a sham acupuncture technique, which was done on areas of the skin in which...

Globalization: Children and working parents pay too high a price

...n home alone or with an unpaid child, the children suffered accidents or other emergencies. In 35 percent of the same cases, the children had suffered from developmental or behavioral problems. 23 percent of parents interviewed took children to work...

Statins, beta-blockers lessen heart attack risk, says Stanford-Kaiser study

...001-03. Of those patients, only 20 percent who had suffered a heart attack were on a statin, compared with 40 ...presented with exertional angina. The patients who suffered a heart attack "out of the blue" were much less likely than those who had only angina to be taking s...

Indoor pollution from cooking on wood stoves affects women in developing countries

... died as a result of biomass smoke exposure and 99 suffered from fatal COPD associated with tobacco smoke. Sixty percent of the deaths in the tobacco smoke cohort came from respiratory failure, while 48 percent of the wood smoke patients died from the same problem....

Healthy pre-term infants show reduced lung function

...ficant ventilatory support after birth and had not suffered prior lower respiratory infections. A minority of the premature infants in the study cohort required supplemental oxygen in the first two days of life. "This study demonstrates an independent effect of gestational age on expiratory flows," said Dr. J...

Alzheimer's disease neuroimaging study launched nationwide by National Institutes of Health

...cements. She has a number of dear friends who have suffered the effects of AD. ADNI is the largest public-private partnership on brain research underway at the NIH, U.S. Department of Health and Human Services (DHHS). In addition to the NIA, the Federal ADNI partners are the National Institute of Biomedical I...

Penn study identifies patients most at-risk for secondary strokes

Among patients who have suffered a single stroke, researchers at the University of Pennsylvania School of Medicine, along with colleagues at other institutions, have found that severe stenosis, or narrowing, of the arteries in the head represents a major risk factor for the developm...

1 2 3 4 5 6 7 8 9 10

(Date:10/31/2014)... good for attracting species, but it may not be enough ... study has found. , The researchers surveyed two types of ... abundance of two insects that interact with them. They found ... and black walnut, they didn,t find a corresponding abundance of ... the walnuts and black cherries and a type of wasp ...
(Date:10/31/2014)... 30, 2014  HITLAB SM , a healthcare ... its inaugural HITLAB Innovators Summit SM on ... HITLAB will partner with the Clinton Foundation,s Health ... ProtoHack, Columbia Business School Alumni Club of ... Engineering and Operations Research, bringing together leaders in ...
(Date:10/30/2014)... 2014—Oligonucleotide-based therapeutics present unique challenges when it comes ... developmental harm. New consensus guidelines for toxicity testing ... biological characteristics of these novel biopharmaceuticals are presented ... journal from Mary Ann Liebert, Inc. publishers ... Nucleic Acid Therapeutics website until November ...
Breaking Biology News(10 mins):Green spaces don't ensure biodiversity in urban areas 2HITLAB Announces Inaugural HITLAB Innovators Summit 2HITLAB Announces Inaugural HITLAB Innovators Summit 3New guidelines for reproductive & developmental toxicity testing of oligonucleotide drugs 2
Other Tags
despiteeasyfrogsdeformedarrivestartpartyamokcorporateresponsibilitywalkspercentageaffectingfundsaimssporting