Tag: "tone" at medical news

Some women benefit more from exercise when emphasis is on health, not appearance

...ce by making comments about how the exercise would tone their legs or other body parts. We want to design the most beneficial exercise programs for different groups of people, and understanding how people respond to different approaches to exercise is key to doing so, Focht said. We chose a very specifi...

Rosiglitazone -- Seeking a balanced approach to avoid panic among patients

...nd the risk of death by heart attack by 64%. The tone of the NEJM paper is one of urgency, yet GSK has responded by stating it "strongly disagrees" with its conclusions. Who is right" Of studies to date, the two most reliable to inform decision making are DREAM (published in The Lancet) and ADOPT (pub...

Study shows Botox decreases pain and intensity of spasticity following a stroke

...significant reduction in pain and excessive muscle tone at each follow-up. In addition, average pain intensity was significantly reduced. "Early intervention with effective therapies is absolutely vital to prevent the profound disability that afflicts many stroke patients," said Brashear. "Having data t...

Research finds music training 'tunes' human auditory system

... English speakers with no knowledge of Mandarin, a tone language. In tone languages, a single word can differ in meaning depending on pitch patterns called "tones." For examp...

Low-pitch treatment alleviates ringing sound of tinnitus

...vided temporary relief from the high-pitch ringing tone associated with the disorder. Tinnitus is caused by injury, infection or the repeated bombast of loud sound, and can appear in one or both ears. Its no coincidence that many rock musicians, and their fans, suffer from it. Although known for its hi...

Bioterrorism alerts induce anxiety and may pose health risk, Einstein study finds

...case of bioterrorism, or a message more neutral in tone that presented bioterrorism as a risk that was minor relative to other public health challenges. Those receiving the more potent message became the "experimental" group, while those receiving the more neutral message were considered the "control" gro...

Researchers discover mechanism that determines when detailed memories are retained

...encies. During some of the trials, they paired one tone with stimulation of a section of the rats' brains known as the nucleus basalis, which relays commands to the auditory cortex by secreting acetylcholine. During some experiments, the stimulation of the nucleus basalis was weak, whereas in other animal...

Foodborne pathogens hard to remove from produce, research is ongoing

...in on the shelves at this time. If his reassuring tone makes the scientist sound less than aggressive toward E. coli 0157:H7 and other foodborne pathogens, you're mistaken. Martin and fellow U of I professor Hao Feng are dedicated to discovering ways to keep these microorganisms out of the food supply. ...

Study identifies part of brain responsible for tone deafness

...study examined the structural neural correlates of tone deafness. Magnetic resonance imaging data from a group of tone deaf people were compared with the images of people with normal musical ability to find out what are...

First evidence that musical training affects brain development in young children

...children listened to two types of sounds: a violin tone and a white noise burst. MEG is a non-invasive brain scanning technology that measures the magnetic fields outside the head that are associated with the electrical fields generated when groups of neurons (nerve cells) fire in synchrony. When a soun...

Hormone-replacement therapy hurts hearing, study finds

...ises her hand or presses a button when she hears a tone was used to measure which frequencies each woman could hear. In addition, the team did two sophisticated tests in which a sound was sent into each woman's ear, and then the echo coming back out was measured. These tests tell scientists how healthy a...

Hearing loss and high-speed dental tools

...ople experience momentary tinnitus, a high-pitched tone that lasts up to 30 seconds. Acute tinnitus, however, can last days or weeks and is most commonly caused by exposure to loud noise such as music at a rock concert, power tools or gunfire. The subsequent ringing indicates damage to the tiny hair-like ...

Distressed by your babys distress? How you respond matters

...your child through your facial expression and your tone of voice that you understand how she feels and that you empathize with her," the researcher said. "Respond in a timely way to your infant's cues, and let your interactions with your infant be driven by the baby's agenda, not your agenda," she added...

Aggressive heart pacing may work best in some spinal cord patients

... have lost their sympathetic response so the vagal tone is always predominating. In patients showing ongoing symptoms, we found it's much more important to go ahead and put that transvenous pacemaker in and keep them stable." While the researchers suggest rapid preventive action in patients with recurri...

Enzyme inhibitor may provide strategy to treat some GI disorders, Jefferson researchers find

...e (ROK) plays an important role in maintaining the tone of the internal anal sphincter (IAS), which is crucial for normal bowel functioning. When the IAS tone is too high or "hypertensive" the result can be constipation, anal fissures and hemorrhoids. Block...

Science finds new fix for UV-damaged skin in arthritis treatment

...ows up as unsightly dark splotches and uneven skin tone over time. But new research indicates that glucosa..., showed improvement in hyperpigmentation and skin tone and a decrease in the size of age spots. The research is set to be presented in July at the "Academy...

Womens skin tone influences perception of beauty, health, age, sociobiologists find

...stand that wrinkles are not the only age cue. Skin tone and luminosity may be a major signal for mate sele...ubjects who were judged to have the most even skin tone also received significantly higher ratings for attractiveness and health, and were judged to be youn...

Women leaders call for global action on osteoporosis

...eakers at the event, whose statement reflected the tone of the gathering. See IOF website for complete texts from all the speakers: http://www.osteofound.org/wco/2006/media_centre.php . The women, who come from the fields of public service, journalism, medicine, fashion and the arts, politics, philanthro...

Varying effects of fish consumption on atrial fibrillation

...y acids may accentuate vagal tone. Enhanced vagal tone has been shown to protect against ventricular fibr...oung, healthy population of physicians where vagal tone may have a more significant impact. "The message of this study is not to stop eating fish. AF is a c...

Do testosterone patches help women with under-active pituitary glands?

...an be blamed for loss of sex drive, loss of muscle tone and decrease of cognitive sharpness. Researchers, led by Karen K. Miller, M.D., wanted to determine whether using physiological testosterone replacement in the form of dermal patches would improve (1) bone density, (2) body composition and (3) neuro...

1 2

(Date:5/22/2013)... biodiversity of pollinating insects and wild plants have slowed ... Researchers led by the University of Leeds and the ... of dramatic reductions in the diversity of species in ... 1980s. , But the picture brightened markedly after 1990, ... among bees, hoverflies and wild plants. , ...
(Date:5/21/2013)... shows that the nation,s land and water resources could ... up to 25 billion gallons of algae-based fuel a ... yearly needs. , The findings come from an in-depth ... to grow significant amounts of algae in large, specially ... May 7 issue of Environmental Science and Technology ...
(Date:5/21/2013)... Michigan Water Center today awarded 12 research grants, ... and protection efforts. , The two-year grants of ... efforts to track the remediation of harmful algae ... non-native weedy plant invasions; study chromosomal damage in ... restoration activities. , The grants were awarded to ...
Breaking Biology News(10 mins):Encouraging signs for bee biodiversity 2Encouraging signs for bee biodiversity 3Going green: Nation equipped to grow serious amounts of pond scum for fuel 2Going green: Nation equipped to grow serious amounts of pond scum for fuel 3Going green: Nation equipped to grow serious amounts of pond scum for fuel 4U-M Water Center awards $570K in Great Lakes restoration grants 2U-M Water Center awards $570K in Great Lakes restoration grants 3U-M Water Center awards $570K in Great Lakes restoration grants 4
Other Tags
penniesswallowgabapentinrelievedlocationtanningguardiansleuthresponsibilitywalkspercentagerankingsavoidscoolingminiinvestigated