The Latest Biology News And Medical NewsBiology News 2Health News 2Biology News 3Health News 3


Tag: "trials" at medical news

Space technology benefits medical community

...altimore, developed and recently completed initial trials for a miniature device to help physicians characte...'s design and are gearing up for the next round of trials at JHMI later this winter. Other Applications In addition to monitoring Raynaud's patients, thi...

Hormone drug type makes survival difference in advanced breast cancer

...g both the content and quality of existing medical trials on a topic. The treatment of advanced breast can... the review found very little reliable data in the trials comparing the effectiveness of the different available aromatase inhibitors. "The promotion of one i...

The problem with treating spondylarthritis with anti-TNF strategies

.... Luyten states. "Long-term results from clinical trials are required to corroborate this hypothesis in patients with SpA," he acknowledges, "and to define whether the process of ankylosis should become a separate therapeutic target."...

Researchers: Few heart disease trials reporting sex-specific results

... understood because women are included in clinical trials far less than men, and even when women are include...hows that three-fourths of clinical cardiovascular trials published in leading general medical and cardiology journals during the last six months of 2004 did ...

University Hospitals Case Medical Center researcher awarded

...Berger said. The Talents grants support research trials conceived by researchers and clinicians with an interest in intravenous immunoglobulin (IGIV) therapies. The Talecris Talents Awards are designed to help further advance research that addresses the use of IGIV as either an antibody replacement thera...

NIH awards $1 million to Temple University Hospital for neurological treatment studies

...ve is designed to facilitate high-quality clinical trials in multiple types of emergency neurological disord...r 11 national sites to perform wide-scale clinical trials testing the effectiveness of new treatments for neurological emergencies, which include traumatic br...

New hope for septic shock patients

... Prof Bellomo said. "The first stage of clinical trials soon to be conducted will give us an indication of the potential benefits of our new kidney protective septic shock treatment," he said....

NHLBI awards 12 Women's Health Initiative contracts

...ticipated in one or more of the three WHI clinical trials or in the observational study. The total cost of a...rmone therapy, calcium-vitamin D, and low fat diet trials and the investigators will have access to blood hormone and vitamin D levels in many of these WHI pa...

Daily use of antidepressants associated with increased risk of fracture in older adults

...urther studies that include controlled prospective trials are needed to confirm our findings."...

Adding radiation decreases breast cancer recurrence

...by under-representation of older women in clinical trials and prognostic studies. Led by Ann M. Geiger, M.P.H., Ph.D., of Wake Forest University School of Medicine and formerly of Kaiser Permanente Southern California, researchers retrospectively followed 1,837 women over 65 for ten years who were treate...

Tamoxifen discontinuation rates surprisingly high in clinical practice

...ion or non-persistence rates estimated by clinical trials range from 16 to 32 percent. Studies of usage outside clinical trials report non-persistence rates of only 17 percent at two years and 31 percent at five years. However, ...

Transdermal vaccine effective in treating Alzheimer's disease in mouse model

...tive benefits," Dr. Tan said, "we believe clinical trials to evaluate a beta amyloid skin patch or topical cream in patients with Alzheimer's would be warranted."...

Study finds differences between blood pressure medicines and newly-diagnosed diabetes

...lyzed the data from all of the randomized clinical trials (in which the assignment of initial drugs is based...tistics, analyzed 22 long-term randomized clinical trials of each class of antihypertensive drugs, including placebo (inactive sugar-pills), to assess the cha...

New international study to test exercise in heart failure patients

...the American Heart Journal. "Controlled clinical trials have shown that exercise training improves physiol...hey said after analyzing 14 trials. "None of these trials enrolled a sufficient number of patients to properly evaluate the impact of exercise training on dea...

New amfAR research grants aim to advance understanding and prevention of rectal HIV transmission

...tely such a delivery device might be used in human trials of a rectal microbicide, to ensure that all products are tested in a standardized manner that allows comparison of the effectiveness of each of the microbicides. Charlene Dezutti, Ph.D. Magee-Womens Research Institute and Foundation, Pittsburgh,...

New angiogenesis inhibitor has promise for treating deadly brain tumor

...ncer-fighting agents. While the earliest clinical trials did not meet expectations that these drugs would '...ter this year. They also are exploring additional trials to further define the role of AZD2171 in glioblastoma treatment and hope to study the drug in combin...

Rotavirus vaccine papers win the Lancet's Paper of the Year 2006

...ithdrawal on safety grounds of RotaShield, but the trials conducted by Ruiz-Palacios and colleagues and Vesi... again. We congratulate the investigators of those trials for doing what we consider to be the best medical research of the year."...

JRRD releases single-topic issue focused on vision rehabilitation

...s of rejection of the prosthesis existed. Clinical trials to determine whether visual improvements exist in patients implanted with subretinal devices of similar design are in progress, while animal studies address the mechanisms that may underlie these improvements. Nonmydriatic teleretinal imaging imp...

SCAI issues clinical alert on drug-eluting stents and late thrombosis

...ypes of lesions treated in the original controlled trials it is about 0.2% excess (compared to bare metal st...zed for each patient. Several large multicenter trials to better define the risk of late stent thrombosis and assess strategies to prevent this complicatio...

Penn researchers demonstrate ability of new therapy to treat severely elevated cholesterol levels

...Squibb then donated it to Penn for use in clinical trials in patients with severe cholesterol problems. Rader and his team at Penn designed and carried out the current study in homozygous FH patients with support from the Doris Duke Charitable Foundation. Due to the success in this study, Penn has licensed ...

1 2 3 4 5 6 7 8 9 10

(Date:1/7/2009)...idge, MA January 7, 2009 Phylonix Pharmaceutica...a $1,250,369 Phase II Small Business Innovation Re... General Medical Sciences of the National Institut...says for assessing drug effects on Cytochrome (CYP...evelopment, is required by the Food and Drug Admin...
(Date:1/6/2009)...more, MDStem cells are the body,s primal cells, re...specialized types of cells over many cycles of cel...arnegie Institution have identified a gene, named ...g a variety of stem cells in their undifferentiate...ir potency has implications both for our knowledge...
(Date:1/6/2009)...ORK, Jan. 6, 2009 Scientists have discovered a ne...lated bacterial species, a finding that raises the... toxins and other disease-aiding factors may be mo...tory experiment, the scientists from NYU School of... notorious bacterium that causes toxic shock syndr...
(Date:1/6/2009)...NNATI Mutation of a gene that helps proteins migr...r the nucleus puts some families at higher risk ...ng encephalopathy (ANE). , This is the conclusio... American Journal of Human Genetics , and currentl... Cincinnati Children,s Hospital Medical Center. ,...
Breaking Biology News(10 mins):NIH grants Phylonix Phase II SBIR to develop high-throughput in vivo zebrafish assays 2'Scrawny' gene keeps stem cells healthy 2NYU scientists discover dangerous new method for bacterial toxin transfer 2NYU scientists discover dangerous new method for bacterial toxin transfer 3NYU scientists discover dangerous new method for bacterial toxin transfer 4Genetic mutation causes familial susceptibility for degenerative brain disease 2Genetic mutation causes familial susceptibility for degenerative brain disease 3Coley Pharmaceutical Group to Present at the Acumen BioFin Rodman 26 Renshaw 9th Annual Healthcare Conference 5136 1Response Genetics Announces Presentation Webcast at BIOCOM Investor Conference 5134 1Response Genetics Announces Presentation Webcast at BIOCOM Investor Conference 5134 2Latino Advocacy Group Investigates Immigrant Dumping by U S Employers 5132 1Latino Advocacy Group Investigates Immigrant Dumping by U S Employers 5132 2Roche Offers Innovative Website Designed to Empower Cancer Patients 5130 1Roche Offers Innovative Website Designed to Empower Cancer Patients 5130 2
Other Tagssole 2sole 3sole 4sole 5valve 2simplify 2arising 2arising 3arising 4markedly 2markedly 3markedly 4markedly 5markedly 6shaping 2awarded 2awarded 3awarded 4awarded 5awarded 6awarded 7awarded 8awarded 9awarded 10trauma 2trauma 3trauma 4trauma 5trauma 6serious 2serious 3serious 4serious 5serious 6serious 7serious 8serious 9serious 10
soleabgenixhungriestweedkillerbassvalvesimplifyarisingmarkedlychihanticonvulsantshapingawardeduclatraumaserious