Tag: "triggering" at medical news

West Africa: meningitis epidemics driven by the wind

...ion of the MCM bacteria to the blood and hence for triggering meningitis epidemics. Through their involvement in the AMMA programme (1), researchers from the IRD and partner institutes (2) have just for the first time quantified this link between the epidemics cycle and climate variations. Statistical methods ...

Obesity and insomnia linked by excitability of brain cells

...ly situations, they may support sustained arousal, triggering sleeplessness, leading to overeating," said lead author Tamas Horvath, associate professor in the Departments of Obstetrics, Gynecology & Reproductive Sciences (Ob/Gyn) and Neurobiology at Yale School of Medicine. "The more stress you have, the lower...

Alcohol magnifies the rewarding effects of smoking, even for light smokers

...fects and they were not due to direct smoking cues triggering cigarette craving. In other words," she added, "the greater the alcohol consumption, the greater the urge to smoke." Smoking urge increases occurred during the rising limb of the BAC and were maintained throughout the declining limb. "One theory fo...

Measuring enzymes at end of cancer pathway predicts outcome of Tarceva, Taxol

...dent kinase (CDK) family of enzymes, which are the triggering molecules that allow a cell to grow and divide. CDK cell cycle enzymes are the end target of numerous cellular pathways that are involved in cancer development and progression, the researchers say.Before these studies, no one has been able to accurat...

Animal model demonstrates course of epilepsy

...for ways to prevent atypical febrile seizures from triggering these processes....

A vaccine approach to treating Parkinson's disease

...ot want to actively immunize humans in this way by triggering antibody development, because one could create harmful inflammation," he cautioned. "However, it might be feasible to inject antibodies directly, as if the patient were creating his or her own." The team, the first to identify the presence of these p...

Strong magnetic fields aid severe depression

...ugh the patient's head via two electrodes, thereby triggering an epileptic spasm. This changes the cerebralchemistry in the area of the forehead, a region which, among other things, regulates the emotions and steers the psycho-motor reflexes. Effective therapy bad image One in two patients who previously did...

Neural cell transplants fight immune attack in mice with multiple sclerosis

... been to some degrees successful in rodent models, triggering recovery of function and restoring nerve conduction. However, such repair has only been successful in isolated areas of the brain, whereas MS and MS-like diseases in animal models involve lesions scattered throughout the brain and spinal cord. Findin...

Discovery of T-cell 'traffic control' boosts new drug promise

...own G-coupled receptors to prevent chemokines from triggering T cell movement. In ways not yet fully understood, this process is reversible, providing the body with a crucial control over when and how much of the potent T cell soldiers to release into the blood stream....

National Institutes of Health accept clinical study of Zestra(TM) for women

...ecognized the critical role of sexual sensation in triggering the entire cascade of events involved in female sexual response and pleasure. The role of sensation is now at the forefront of female sexual medicine research. Recently published research in the American Journal of Obstetrics and Gynecology (ACOG) ha...

A new understanding of how immune system targets disease

...mune response, while ignoring the rest? Those few, triggering protein fragments are termed "immunodominant." Unfortunately, the immune system sometimes makes poor choices about which epitopes to pay attention to, and which to ignore. Understanding of how immunodominance is conferred would enable vaccine designe...

Biosensor reveals new information about suspected cause of Alzheimer's disease

...tructure of a miniscule toxic protein suspected of triggering Alzheimers disease. The findings, researchers say, could help scientists better understand the underlying mechanisms of the disease and lead to the development of new treatments that could slow or possibly arrest its progression. The findings also co...

Trial at Jefferson shows new drug may help cancer patients who need stem cell transplants

...on. AMD-3100 blocks a specific cellular receptor, triggering the movement of stem cells out of the bone marrow and into the circulating blood, boosting the supply of marrow stem cells available for transplantation. Stem cell transplantation entails collecting certain types of cells known as hematopoietic stem ...

Kids at risk of TV / videogame seizures - Experts release new recommendations on reducing risk

...when they are exposed to visual stimuli capable of triggering the abnormal response. The same increased risk exists for children with known epilepsy who can be photosensitive, as well." In a separate report also released today, the Epilepsy Foundation has issued recommendation for industry concerning technic...

National funding goes to Johns Hopkins to advance research on stem cell therapies for heart attack

...hose from another donor, there would be no risk of triggering an immune response that could cause rejection. The treatment concept is based on Marbn's recent success in replicating large numbers of cardiac stem cells in the lab within a very short time, as little as four weeks. The stem cells, extracted fr...

Autoimmune overload may damage HIV-infected brain

... 100 times faster than in other parts of the body, triggering white blood cells to continually swarm to attack the infection. The associated overcrowding and inflammation appear to cause the dementia. Earlier studies had suggested that the build-up of white blood cells could lead to HIV-related dementia, but ...

The 'upstairs/downstairs' mystery of cell suicide is burdened by too much evidence

...er which signaling pathways are most important for triggering this process, according to Douglas R. Green, Ph.D.... therapeutic applications of such control would be triggering cancer cells to commit suicide. "But we can't design definitive treatments until we understand which...

Mechanism controlling DNA damage response has potential novel medical applications

...dy by either preventing that cell from dividing or triggering a cascade of molecular signals that causes that cell to commit suicidea process called apoptosis. In this way, p53 rids the body of useless cells and prevents cells with potentially cancer-causing mutations from multiplying and spreading. Failure of ...

Fatty foods fight inflammation

...hey were foreign invaders. They also suggest that triggering this fat-driven chain of events in patients might provide a way to reduce inflammatory complications after surgery....

Curcumin halts spread of breast cancer in mice

...another. Taxol produced the inflammatory response, triggering metastasis, and curcumin suppressed it, causing cell death. Extracted from the roots of the curcuma longa plant, curcumin is a member of the ginger family. While it is not used in conventional medicine, it is widely prescribed in Indian medicine as a...

1 2 3 4 5

(Date:5/17/2013)... Shenzhen, China---- Why Tibetan antelope can live at ... a collaborative research published in Nature Communications ... institutes provide evidence that some genetic factors may ... highland environments. The data in this work will ... and the biology of other ruminant species. , ...
(Date:5/17/2013)... team of scientists using a new X-ray method recorded ... frog embryo in greater detail than ever before., This ... and the search for new treatments for genetic diseases., ... Technologie in Germany, in collaboration with the Advanced Photon ... Laboratory, released the most precise depiction ever of the ...
(Date:5/16/2013)... fast food restaurant had a higher body mass index ... food, according to researchers at The University of Texas ... strong among those with a lower income. , ... Journal of Public Health indicates higher BMI associates ... among lower-income African-Americans, the density, or number, of fast ...
Breaking Biology News(10 mins):The genome sequence of Tibetan antelope sheds new light on high-altitude adaptation 2New X-ray method shows how frog embryos could help thwart disease 2Body mass index of low income African-Americans linked to proximity of fast food restaurants 2Body mass index of low income African-Americans linked to proximity of fast food restaurants 3
Other Tags
naturetoldentrepreneursrepellentsfiringmixesriboswitchespeekscryingnighttimechronicinfantsmaasiowacabonathan