Tag: "triggers" at medical news

Hormone regulates fondness for food

...general. Research is needed to find out how leptin triggers other chemicals in the brain and how alteration of these pathways contributes to overeating and obesity. Understanding how brain systems interact with hormones that signal hunger and energy stores will provide us with a more complete picture of fa...

Why women get more migraines than men

...s these include genes, hormones and environmental triggers such as stress, diet, changes in sleep patterns and a host of others. While it is known that migraines in females fluctuate with the menstrual cycle and are more frequent during the menstrual period, the study results appear to be independent of a sp...

Chemical in brain acts like a fuel gauge

The concept that a drop in blood sugar triggers a craving for food is best understood just before lunchtime. But exactly how the process unfolds has proven difficult to explain, even on a full stomach. Solving the puzzle would yield new insights in the fight against diabetes. Neuroscientists ...

Mayo researchers discover overdiagnosis of long QT heart syndrome

...th, often related to physical exertion or auditory triggers such as an alarm clock. However, most cases can be diagnosed following warning signs that suggest its potential presence and from objective data derived from an electrocardiogram (ECG), exercise or adrenalin stress testing, and genetic testing. Genet...

'Energy Up' demonstrates success as obesity intervention program for inner-city girls

...based program does. Studies show that binge eating triggers the same neurological pathways as drug addiction, so Voltages theories are rooted in science. Furthermore, recent studies of carbohydrate consumption support that these foods affect satiety, and can trigger over eating. The corner stone of "Energy ...

Detecting cold, feeling pain: Study reveals why menthol feels fresh

..., and in 2000 reported that, in mice, the receptor triggers the nerves to fire pain signals when they are exposed to high ambient heat or the fiery properties of peppery food. (Science, April 14, 2000). The study demonstrated that capsaicin and noxious heat elicit the sensation of burning pain through activat...

Mercury's link to heart disease begins in blood vessel walls

... can be traced to activation of this enzyme, which triggers a process leading to plaque buildup in blood vessel walls. The study examined three forms of mercury, matching its characteristics in the environment. Each form of mercury caused changes in the behavior of cells that line the blood vessel walls and...

MIT reports key pathway in synaptic plasticity

...eceptors for the neurotransmitter glutamate, which triggers the cell's electrical activity during development ...known as NMDA receptors, which activate BDNF. BDNF triggers a signaling pathway involving another well-studied duo, PI3 kinase/AKT. That pathway causes more PSD...

Sleep apnea increases risk of heart attack or death by 30 percent

...ography or bypass surgery) or died. Sleep apnea triggers the bodys fight or flight mechanism, which decreases the amount of blood pumped to the heart. Repeated episodes every night for a few years can starve the heart of enough oxygen when it is combined with the bodys decreased oxygen intake due to the fr...

Sleep apnea may increase risk of diabetes

...activates the bodys fight-or-flight response. This triggers a cascade of events, including the production of high levels of the hormone cortisol that ultimately leads to insulin resistance and glucose intolerance, pre-diabetic conditions that, if left untreated, can lead to the development of diabetes. Low ox...

Research demonstrates link between domestic violence and asthma

...mon respiratory condition. Classic environmental triggers for asthma have been carefully studied, but there is less information on the role of stress in asthma episodes," says lead researcher S.V. Subramanian, Assistant Professor in the Department of Society, Human Development and Health at HSPH. The risk ...

Mice with a migraine show signs of brain damage

...ve to prevent the headaches, by avoiding a persons triggers for the headaches and by using medications prescribed by doctors to prevent them. Normally, the focus of migraine treatment is to reduce the pain. Were saying that migraines may be causing brain damage, and that the focus should be on prevention, w...

Hay fever can send work productivity down the drain

...llen from grass and trees. IgE is an antibody that triggers allergic reactions. In a previous study, Szeinbach found that the ImmunoCAP IgE blood test was more accurate in diagnosing allergies when compared to other specific IgE blood tests. While IgE testing is traditionally the realm of allergists, more a...

Livestock interventions can protect lives, livelihoods

... for drought and other crises, and clearly defined triggers which allow these plans to be activated. These ideas are not new, but aid agencies both donors and NGOs struggle with this approach. We also need to continue strengthening the local services which pastoralists need and, in particular, support far g...

Consumer nail gun injuries spike

...s the widespread adoption of safer sequential-trip triggers could reduce the number of injuries, both for prof...njuries, we believe that the adoption of the safer triggers would be more effective, especially since many consumers and even workers -- do not receive adequat...

Researchers hot on the trail of brain cell degeneration

...s, neurons in the brain are over-stimulated, which triggers programmed cell death, or apoptosis. The study shows that the Rho protein, which has long been recognised as an important player in cancer formation, also plays a key role in the destruction of neurons in disease. "These surprising findings add an ...

Garlic does not appear to lower cholesterol levels

...round information in the article. Crushing garlic triggers the formation of a compound known as allicin, which has been shown to prevent the formation of cholesterol in the laboratory. However, clinical trials on garlic as a cholesterol-lowering agent in humans have been inconsistent. Christopher D. Gardn...

The Natural Fat-Loss Pharmacy by Dr. Harry Preuss

...tamarind fruit, HCA interferes with an enzyme that triggers the formation of fatty acids, cholesterol and trig...s lower blood levels of leptin (the substance that triggers hunger), increases serotonin and fat oxidation, and increases production of glycogen, leading to a f...

The problem with treating spondylarthritis with anti-TNF strategies

...ed by abnormal cartilage and bone formation. What triggers ankylosis remains unknown. Currently, inhibition of tumor necrosis factor (TNF) is the most effective strategy for controlling the painful symptoms of SpA and slowing vertebral joint destruction. But does anti-TNF therapy do anything to reduce the...

Media coverage of autism differs dramatically

...cent of published research was about environmental triggers of autism. "What was very interesting is that media frequently reported being very skeptical of the MMR evidence, as was scientific literature," said Judy Illes, PhD, associate professor of pediatrics and senior author of the paper. The media stori...

1 2 3 4 5 6 7

(Date:6/17/2013)... CORVALLIS, Ore. Amphibian populations are declining worldwide and ... be spread by bullfrogs, but a two-year study shows ... suggestions that bullfrogs are a tolerant carrier host that ... frogs from eggs in controlled experimental conditions, they found ... dendrobatidis , also called Bd or a chytrid fungus, ...
(Date:6/16/2013)... prevention programs for female sex workers in India reduce ... (STIs), a University of Toronto study has found. ... HIV, mostly in the southern states of Andhra Pradesh, ... Professor Prabhat Jha from U of T,s Dalla Lana ... for Global Health Research (CGHR), examined the impact of ...
(Date:6/16/2013)... ago triggered a similar marine ecosystem crisis to those ... warming, according to research published today in Nature ... universities of Newcastle, UK, Cologne, Frankfurt and GEOMAR-Kiel, confirms ... the marine ecosystem during the mid-Cretaceous greenhouse period. ... amplitude and duration of the temperature change.,Analysing the geochemistry ...
Breaking Biology News(10 mins):Bullfrogs may help spread deadly amphibian fungus, but also die from it 2HIV prevention among female sex workers in India reduces HIV and syphilis 2Global cooling as significant as global warming 2
Other Tags
comparablemarimastatketektenthdarklyairwayeditsfluorideappropriationsconveysasmusualunprovengambiaopposeshivma