Tag: "upgrading" at medical news

Voice-to-voice translation machine perfects bedside manner

...estions. The system is in a continuing process of upgrading and improvement. Simultaneously with the presentation at the ACL conference, use testing was in process at a military facility. In addition to the researchers and institutions already named, Malibu California-based HRL Laboratories works with USC on...

University of Queensland and Harvard Medical International to nourish the health workforce

...neration of the health workforce, as well as those upgrading the skills of established professionals. "Busy clinicians will now be able to achieve the gold standard for medical education internationally, without having to travel to Boston. "In Brisbane, they will be immersed in an advanced eight-day program e...

Asia-European collaboration addresses water management in Indonesia

...ed water resources management, also supporting and upgrading their research. They are already developing innovative educational methods and technologies to improve the quality of their teaching and learning; and strengthening Indonesia's institutional capacity to implement efficient water resources manage...

Quality improvement effort pays off in diabetes care

...the University of Chicago. "A small investment in upgrading the delivery of health care brought about a substantial improvement in health that justified the costs of the program." "Unfortunately," he added, "the people who make such financial investments are not the people who directly benefit from them." ...

'Supersize me' mice research offers grim warning for America's fast food consumers

...s research that may have you thinking twice before upgrading to the large size at your favorite fast food joint. Saint Louis University research presented this week in Washington, D.C., shows the dangers of high-fat food combined with high fructose corn syrup and a sedentary lifestyle in other words, what may...

New Orleans levee report finished by panel including University of Texas at Austin engineer

...y on levees isnt the answer, Gilbert said, because upgrading them is expensive, and its difficult to anticipate the magnitude of future storms, which can impact a small portion of a levee system and have catastrophic consequences. He also noted that higher levees can create greater danger because of the higher...

Columbia dentists to improve oral health in sub-Saharan Africa

...supporting basic health interventions, building or upgrading clinics, and expanding the pool of community or village health workers. The participating villages are integral partners in the project and take responsibility for the interventions. In addition to the oral health initiative, the new funding will s...

1

(Date:8/28/2014)... -- Scientists have identified the developmental on-off switch for ... produce more than two-thirds of the world,s naturally derived ... to see whether it is possible to manipulate this ... , The study, appearing August 28 in Cell ... molecule called cyclic-di-GMP and a larger protein called BldD ...
(Date:8/28/2014)... method for measuring and imaging how quickly blood flows ... understand how drug abuse affects the brain, which may ... lead to better treatment options for recovering drug addicts. ... from Stony Brook University in New York, USA and ... in The Optical Society,s (OSA) open-access journal ...
(Date:8/28/2014)... the first person to alert the world to Global ... be captured and stored underground. He says that Carbon ... the best way to avoid global warming getting out ... (Columbia University, New York) made the call during his ... where 150 scientists are meeting to discuss Carbon Capture ...
Breaking Biology News(10 mins):Small molecule acts as on-off switch for nature's antibiotic factory 2Small molecule acts as on-off switch for nature's antibiotic factory 3This is your brain's blood vessels on drugs 2This is your brain's blood vessels on drugs 3Global warming pioneer calls for CO2 to be taken from atmosphere and stored underground 2
Other Tags
speedycootsovulationperimenopausalpeeksgenesystemsstrepasidewallsbumpdegradationimmunitiesbrandedpolymerpurduesexes