Tag: "urgent" at medical news

New class of HIV drug attacks previously untargeted enzyme

...in this weeks edition of The Lancet. There is an urgent need for new antiretroviral drugs due to existing rates of failure in existing combination antiretroviral therapies. The current study looked at the new "integrase-inhibitor" raltegravir when used in conjunction with optimised background combination ...

Research could lead to treatment for Alzheimer's disease

... professor who designed the molecule. "There is an urgent need for a drug to treat this devastating disease, and the scientific community has been working on this problem for many years." The National Institute on Aging estimates that as many as 4.5 million Americans suffer from Alzheimer's disease, which...

Physicians should be able to review performance rates before release

... reflect the importance of balancing stakeholders' urgent need for useful information with the need for due diligence to ensure that the information provided is valid, reliable, and useful." Voluntary payer utilization of the general guidelines are designed to ensure a fair and accurate process through wh...

A revolution in the monitoring of unborn babies

...fore it is too late to help them. This may involve urgent delivery of the fetus. The device will be especially helpful in monitoring fetuses whose mothers have medical conditions like diabetes, autoimmune conditions such as systemic lupus erythematosus and Sjogrens syndrome and obstetric cholestasis. It w...

Costs of treating arthritis on the rise nationwide, study finds

... steadily to nearly 67 million by 2030. She called urgent attention to the need for cost-effective efforts to decrease medical expenses and increase the earning power of people with arthritis. In 2003, employed adults with arthritis earned an average of $3,613 less than healthy working adults between the ...

Double the death rate from cirrhosis for 'blue collar' men

... most socioeconomically disadvantaged should be an urgent national priority....

Caring for the sick now a public health priority for developing countries

...is difficult to establish in poorer countries, but urgent steps must be taken to deliver these services."...

$2.6M grant awarded to New York University College of Nursing

... teaching assessments of older adults is even more urgent in associate degree programs since, to date, other geriatric assessment initiatives have focused primarily on higher degree programs. Given that 63% of those entering the nursing workforce are graduates of associate degree nursing programs, the need...

AGA Institute takes leadership role in exploring obesity and its complications

...read effects of obesity on a persons health, it is urgent that the AGA Institute collaborates with other leading medical organizations to encourage a multidisciplinary approach to the treatment of our patients to most affectively address their health needs, said Dr. Kaplan. The research found in this spec...

Asthma study shows patients have more options to control disease

...ups. Treatment failure included hospitalization or urgent medical care, the need for additional medications for asthma, a decline in lung function, or the need to take more than 10 puffs a day of a "rescue" inhaler for two consecutive days. The groups taking twice-daily fluticasone and once-daily fluticas...

Brain research poised to dramatically advance global society

...ics and economics. The panel will also explain the urgent need to continue the study of the human mind and the benefits this research could bring to society. "It is our intention to cover a lot of ground in two days because we need to capture the magnitude of the impact of what we are proposing to Congres...

New technique effective in closing accidental colonoscopy wounds

...r puncture the colon. Most of these patients need urgent surgery to close the wound and spend 10 days in the hospital. One in 10 dies, usually because delays in closing perforations allow colon contents to leak into the abdominal cavity, causing deadly conditions such as peritonitis and sepsis. Now, howe...

HIV and malaria combine to adversely affect pregnant women and their infants

...tes pregnancy-associated malaria (PAM) there is an urgent need to understand these diseases during pregnancy and turn this knowledge into effective therapies. Until now the mechanisms by which pregnant women defend themselves against malaria and how HIV impairs this defence have been unknown, but a paper...

Treating HIV in war zones -- Public health emergencies need rapid advice from WHO

...ict settings Public health emergencies require urgent advice from the WHO Please mention PLoS ...am.msf.org Public health emergencies require urgent advice from the WHO The World Health Organization (WHO) has developed a new mechanism, descr...

May/June Annals of Family Medicine tip sheet

...y improve care. Organizational leadership with an urgent vision for change is critical to successful quality improvement efforts in medical practices. The authors further cite specific leadership qualities, including the ability to manage and change process and selection of systematic changes capable of f...

New study could bring relief to sweltering city slickers

...oped for cities and regions in the UK, there is an urgent need for decision support tools to appraise and design adaptation options. The science and practice of adaptation of the built environment to climate change is still in its infancy. We hope this project will pave the way for further research and wo...

Experts call for urgent research into anti-epileptic drugs given to children

Researchers have called for urgent studies into the long-term safety of newer antiepileptic drugs after discovering that the number given to children has increased significantly over recent years, reports the June issue of British Journal of Clinical Pharmacology. When the UK team s...

CAM-oriented primary care providers result in cost savings, high patient satisfaction

... The escalation of medical expenditures remains an urgent problem in the United States and its becomingquite clear that cost containment strategies by conventional medical providers are failing to achieve evenmediocre results, said study coauthor James Winterstein, DC. This study confirms that integration o...

Nepalese researchers identify cost-effective treatment for drug-resistant typhoid

...longer duration than is ideal. Clearly there is an urgent need for a treatment that is cost-effective and easy to administer." The results of the study show that a cost-effective new fluoroquinolone drug, Gatifloxacin, may be a better treatment for enteric fever than Cefixime, which is currently recommend...

Trials underway for 'essential' new TB vaccine

...ht years. The need to control TB has become more urgent with the resurgence of the disease in many parts of the world, including a 10% rise in England, Wales and Northern Ireland, and the emergence of multi-drug resistant strains. TB, which is caused by the M. tuberculosis bacterium, is thought to kill...

1 2 3 4 5 6 7 8 9

(Date:5/20/2013)... New research suggests that a compound abundant in the ... death. , By altering a very specific step ... into normal cells that die as scheduled. , One ... process that would cause them to die on a ... study in cells, led by Ohio State University researchers, ...
(Date:5/20/2013)... - A novel vaccine study from South ... that will be unveiled at the American Association of ... takes place Monday, May 20 - Wednesday, May 22 ... , "The main goal of a vaccine is to ... that causes the disease", explained Dr. Hemachand Tummala, assistant ...
(Date:5/20/2013)... USA New Geology articles posted ... 2013 cover a wide swath of geoscience subdisciplines, ... geophysics, and paleobotany. Locations studied include Siberia; the ... Alpi Apuane, Italy; Ukraine; Mars; and the Southeastern ... 1. Rubies, jadeite, and plate tectonics;, 2. The ...
Breaking Biology News(10 mins):The compound in the Mediterranean diet that makes cancer cells 'mortal' 2The compound in the Mediterranean diet that makes cancer cells 'mortal' 3Germ-fighting vaccine system makes great strides in delivery 2New in GEOLOGY: Gems, Darwin, Mars, Hemp, Snowball Earth, a Siberian Impact Crater, and More 2New in GEOLOGY: Gems, Darwin, Mars, Hemp, Snowball Earth, a Siberian Impact Crater, and More 3New in GEOLOGY: Gems, Darwin, Mars, Hemp, Snowball Earth, a Siberian Impact Crater, and More 4New in GEOLOGY: Gems, Darwin, Mars, Hemp, Snowball Earth, a Siberian Impact Crater, and More 5New in GEOLOGY: Gems, Darwin, Mars, Hemp, Snowball Earth, a Siberian Impact Crater, and More 6New in GEOLOGY: Gems, Darwin, Mars, Hemp, Snowball Earth, a Siberian Impact Crater, and More 7New in GEOLOGY: Gems, Darwin, Mars, Hemp, Snowball Earth, a Siberian Impact Crater, and More 8New in GEOLOGY: Gems, Darwin, Mars, Hemp, Snowball Earth, a Siberian Impact Crater, and More 9New in GEOLOGY: Gems, Darwin, Mars, Hemp, Snowball Earth, a Siberian Impact Crater, and More 10New in GEOLOGY: Gems, Darwin, Mars, Hemp, Snowball Earth, a Siberian Impact Crater, and More 11
Other Tags
confidentialitydisorderspsychiatricfindingtakecampaignsmediaasmsubarachnoidfetusesantherosclerosisathleticismzincinsertssalediscourages