Tag: "vivo" at medical news

Dead on target

...he researchers are currently conducting further in vivo experiments to evaluate the suitability of this system for clinical applications....

Brightening prospects of using fluorescent nanotubes in medical applications

...highly toxic, and so may not be appropriate for in vivo applications. Nanotube fluorescence is extremely stable and can last for months. Fluorescent proteins widely used for imaging living systems begin fading within a few hours. Quantum dots last several days before degrading. Hertels team is cur...

Nanomedicine opens the way for nerve cell regeneration

...y. Using optic nerve and spinal cord tissues as in vivo models and dissociated retinal ganglion neurons as...y of using magnetic nanoparticles for enhancing in vivo axon regeneration, this work may have significant implications for the treatment of spinal cord inju...

Blocking immune cell action increases Alzheimer's-associated protein deposits

...d early online release. "Our results provide in vivo evidence that the brain's immune system plays a protective role in early Alzheimer's disease by mediating the clearance of amyloid-beta," says Joseph El Khoury, MD, of the MGH Center for Immunology and Inflammatory Diseases, the paper's lead author. ...

World first in medical robotics

...y have succeeded for the first time in guiding, in vivo and via computer control, a microdevice inside an artery, at a speed of 10 centimetres a second. Under the direction of Professor Sylvain Martel, holder of the Canada Research Chair in Micro/Nanosystem Development, Construction and Validation, and...

How T lymphocytes attack

...n microscopy to demonstrate, for the first time in vivo and real-time, how T lymphocytes infiltrate a solid tumour in order to fight it. These "defenders" methodically encircle the enemy positions and "patrol" until they meet a tumour cell, which they have previously learnt to recognise. They then halt ...

Common anesthetic may induce cell death, generation of Alzheimer's-associated protein

...thor of the current paper. "We need to conduct in vivo studies before we can determine whether these results might be relevant to the development of delirium or Alzheimer's disease in human patients." Tanzi is a professor of Neurology at Harvard Medical School, where Xie is an assistant professor of Ane...

Leading European experts in magnetic resonance for animals

...rry out magnetic resonance spectroscopy imaging in vivo on animals (from mice to rabbits), and an NMR Bruker AvanceII 600 spectrometer combined with a high-resolution liquid chromatography team and a mass spectrometer. Both pieces of equipment will have various applications, especially in the field of bio...

Dually porous glass shows promise in helping damaged bone regenerate

...aboratory experiments. Ammar is now supervising in vivo tests in Alexandria. The idea for the project originated two years ago when Jain traveled to Alexandria to meet with Mona Marei, director of the tissue-engineering lab at Alexandria's Faculty of Dentistry. Jain and Marei discussed a medical probl...

High-resolution imaging with contrast agent shows promise in osteoarthritis research

...ers must address technical issues involving the in vivo delivery and retention of a sufficient volume and concentration of the contrast agent, they note in the paper. "But even if the technique only works for in vitro studies, it still provides useful quantitative, high-resolution, 3D images that resear...

Math model predicts cancer behavior

...he said. Next up for the group are in vitro and in vivo experiments designed to test, validate and refine the mathematical model....

Pure carbon nanotubes pass first in vivo test

...by the liver. The findings are from the first in vivo animal study of chemically unmodified carbon nanotubes, a revolutionary nanomaterial that many researchers hope will prove useful in diagnosing and treating disease. The research will appear in this week's online edition of the Proceedings of the Nat...

Synchronous neuronal firing may underlie Parkinson's disease

...i Costa, D.V.M., Ph.D., chief of the section of in vivo neural function at the National Institutes of Health, who launched this study as a postdoctoral fellow in Nicolelis' laboratory. "Therapeutic interventions that restore the normal synchrony of these neurons in the brain may potentially be beneficial...

Therapeutic role found for carbon monoxide

...nicate with one another as they otherwise would in vivo in order for CO to exert its beneficial effects?'" To address this question, coauthor Beek Yoke Chin, PhD, developed a simulated blood vessel by growing the cells on a semi-permeable membrane, which enabled the two cell types to "communicate" with o...

New drug target might sidestep gleevec resistance, Jefferson scientists show

...ponds to tamoxifen. "Now we essentially have an in vivo system in which we have leukemia cells that carry a chimeric protein, C/EBP-alpha-ER," Dr. Calabretta explains. "If you activate CEBP alpha by injection of tamoxifen, this chimeric protein is switched on and suppresses tumorigenesis." They also we...

Case and Cleveland Clinic researchers identify molecule in age-related macular degeneration

...f CEPs found in the eye. The researchers did in vivo animal studies with membranes from chicken eggs and rat eyes and found that CEPs attached to proteins induce angiogenesis. They also found that the protein part of CEP-protein adducts is not important for producing the growth of the blood vessels. Ra...

A novel mechanism of manganese-induced neurological dysfunction discovered

...ccording to the study, in addition to decreased in vivo dopamine release, manganese exposure produced subtle deficits in behavior and fine motor function. "More work is needed to understand the relationship between the changes in behavior and the alterations in the dopamine system," explained Jay S. Sch...

First study to show how immune cells 'speak' to each other in vivo

...l significance of mature immunological synapses in vivo during antiviral immune responses. The findings w...ow immunological synapses "speak" to each other in vivo has not been observed prior to this research. Although formal proof of this awaits the development ...

Rush researchers explore nanotechnology as diagnostic and treatment tool

...nder development to follow the tissue stiffness in vivo to diagnose cancer. A second area of research involving nanotechnology uses viral particles as templates to fabricate uniform, nanometer imaging probes and drug carriers. The research team is extracting the DNA from viral particles and replacing ...

Zebrafish show advantages in assessing human cancer cell-induced angiogenesis in vivo

...quire as few as 50 cells for transplant, permit in vivo visualization of cell migration, mass formation and interaction between human cancer and zebrafish cells in the transparent animal, and require small amount of drug per experiment, M vs mM. Since chemicals can be delivered directly in the fish wate...

1 2 3

(Date:8/22/2014)... , August 22, 2014 /PRNewswire/ ... http://www.researchandmarkets.com/research/mtm27l/biometrics_market ) has announced the addition ... America 2014-2018"  report to their offering.  ... , ,Biometrics is a technology that ... based on their physical or behavioral ...
(Date:8/22/2014)... a leading source of information for businesses and professionals, ... Riverside in its 2014 list of "some of the ... generate the list, the company analyzed citation data over ... has had enormous impact. , The following UC Riverside ... the greatest number of highly cited papers in one ...
(Date:8/22/2014)... Jolla, CA Research presented at the 29th ... being developed by Hera Therapeutics Inc. combats three ... cause 70 percent of all cervical cancer. , ... HTI-1968 blocked the replication of HPV-16, HPV-18 and ... and Thomas Broker, Ph.D., who presented the findings ...
Breaking Biology News(10 mins):Biometrics Market in North America 2014-2018: Key Vendors are 3M Cogent, Cross Match, NEC and Safran SA 2Biometrics Market in North America 2014-2018: Key Vendors are 3M Cogent, Cross Match, NEC and Safran SA 35 UC Riverside scientists among world's most influential scientific minds 2
Other Tags
hatchedmurreletmarbledswarmseelgrassisotronspaceswhiffiestdevicewidelyisraelilaunchvanasmebioengineerafraid