Tag: "whole" at medical news

MRI finds breast cancer before it becomes dangerous

...hl concludes from this that Our study demolishes a whole series of textbook dogmas. Firstly, it was always said that MRT was not able to find early stages of breast cancer in the milk ducts. As our results show, the opposite is true. MRT is far more sensitive than mammography.' The second prejudice is that...

Stanford researchers find culprit in aging muscles that heal poorly

...s in a host of different tissues. The key to the whole process is Wnt, a protein traditionally thought to help promote maintenance and proliferation of stem cells in many tissues. But in this instance, Wnt appears to block proper communication. "That was a total surprise," said Thomas Rando, MD, PhD, a...

Rutgers professor Bart Krekelberg is named 1 of 20 US Pew Scholars for 2007

...iology lab and functional resonance imaging of the whole brain at the University Heights Center for Advanced Imaging in Newark. With this grant, we will be allowed to develop the techniques to look at the brain to determine how the pieces fit together, says Krekelberg. My long term goal is to take off th...

Researchers link metal ions to neurodegenerative disease

...he activity governing the assembly and toxicity of whole fibrils with respect to their effect on brain cell...nimal unit actually replicates the activity of the whole fibril on the neuronal cell. And it does so by binding the metal in a specific way," says Dr. Lynn. ...

Cancer research summaries

...nant disease who had received at least one unit of whole blood, erythrocytes, plasma or platelets between 1968 and 2002. All blood donors who contributed to these transfusions were traced through population and health registers and donors who were subsequently diagnosed with a malignancy within 5 years of ...

UD scientists invent novel hydrogels for repairing, regenerating human tissue

... very successful collaboration, Schneider added. A whole host of terrific students and other people on- and off-campus have helped this come to fruition, he noted. Without these students and collaborators, this work would be impossible....

K-State researcher working on a way to make snack foods with extra fiber

...r ailments. "That's where there's a big push for whole grains and fiber," he said. "There's interest in making healthier foods." Funded by a one-year, $30,000 grant from the Kansas Wheat Commission, Alavi and researchers created flour enriched with varying levels of bran. They mixed the bran-enriched w...

Spuds that like you -- in your summer salad

...that they may also have a beneficial effect on the whole immune system. Especially if eaten cold or in a potato salad, Anne Pichon reports in Chemistry & Industry, the magazine of the SCI. Spanish researchers found that growing pigs fed large quantities of raw potato starch (RPS) had a healthier bowel. N...

New mangosteen research establishes xanthone measurement standard

... category is leading scientific exploration of the whole mangosteen fruit (Garcinia mangostana) through a t...dy conducted on XanGo Juice, indicate usage of the whole mangosteen fruit as a delivery vehicle leads to high xanthone absorption. "These two studies put i...

Report calls for new directions, innovative approaches in testing chemicals for toxicity to humans

...s cannot yet adequately mirror the metabolism of a whole animal. Studies observing human populations will be needed to provide information on human susceptibility and "background" exposures to chemicals that people face every day, so that results of the in vitro tests can be properly interpreted. These ...

Split the difference: Pill-splitting study looks at cost-saving step that could be used by millions

...ll and swallowing half of it, rather than taking a whole low-dose pill each time, doesnt change those medic...h-dose pill is far lower than the cost of buying a whole pill containing the same dose of medicine. So, pill-splitting can save money for the insurance plan ...

Oxygen trick could see organic costs tumble

...ut if paying out for these facilities can ensure a whole crop is not rejected by a retailer because it is a little limp or dehydrated, then it is a cost that has to be absorbed, she said. Edna Pesis and her team at the Volcani Center, Israel, have devised what they expect to be an effective and cheap tec...

Researchers develop criteria to detect bone mass deficiencies in children with chronic diseases

... bone density scans on the spine, forearm, hip and whole body to establish reference data for multiple skeletal sites. This comprehensive evaluation of bone status will determine if certain conditions or treatments affect some skeletal sites differently from others. The research was funded by and conducted...

Meningitis: effectiveness of preventive vaccination demonstrated

...e up the Niakhar region, the other in 1999, in the whole of the study area, hit be a series of epidemics between 1998 and 2000. Using quarterly censuses carried out since 1983, the researchers collected then analysed data on childrens state of health and vaccine status. They could therefore make comparis...

DFG approves 11 new Collaborative Research Centers

...nd study their importance for the aging process of whole organs using models. In doing so, it may be possible to develop pharmacological prevention and treatment concepts. (Host university: Heinrich Heine University of Dsseldorf, Coordinator: Jean Krutmann) The rejection of transplanted organs and the sh...

Low-carb diets' effects linked to rise in newly identified 'starvation hormone'

...artling that you can give one hormone and flip the whole metabolic profile." "We think these findings wou...por, Kliewer explained. "When you step back, the whole thing makes sense," he said. "During fasting, the liver hormone communicates with adipose tissue to ...

African-American men understimate risk of prostate cancer

...ate the value of early detection and thus skip the whole process," said study author William Dale, MD, PhD, assistant professor of medicine/geriatrics at the University of Chicago, "which may explain, in part, why African-American men are so often diagnosed later and thus have worse outcomes." Dale and c...

AMPAKINE compounds a new potential treatment for respiratory depression

...ted oscillations similar to those generated by the whole brainstem in vitro, and neurons with voltage-dependent pacemaker-like properties that have been identified in this brain region. In a study published in 2006, Dr. John J. Greer of U. Alberta demonstrated that certain AMPAKINE compounds enhance th...

Flaxseed stunts the growth of prostate tumors

... flaxseed in a ground form because flaxseed in its whole form has an undigestible seed coat, she said. Participants elected to mix it in drinks or sprinkle it on food, such as yogurt. "The results showed that the men who took just flaxseed as well as those who took flaxseed combined with a low-fat diet d...

Increasing radiation dose shortens treatment time for women who choose breast sparing treatment

...cally administered after the four to five weeks of whole breast irradiation and adds another one to two wee...t in addition to safely increasing the dose to the whole breast during the four-week period, it is possible to deliver the "boost" concurrently, eliminating ...

1 2 3 4 5 6 7 8 9 10

(Date:5/21/2013)... battle? Try staying fit in space, where living quarters ... , That,s the challenge a group of Michigan State ... million grant from NASA. Their goal is to keep ... "You could give astronauts the best exercise regimen there ... to it, it isn,t going to help," said project ...
(Date:5/21/2013)... biomass experts , Where? Copenhagen, Denmark: ... 03-07 June 2013 , Why? ... market and policy developments, manufacturing and installation, drawing on ... from its 2013 edition from a record of more ... more than 240 plenary and oral presentations, more than ...
(Date:5/21/2013)... The epigenetic modifications, which alter the way genes ... apparently be detected in the blood of pregnant ... way to foretell depression in the weeks after ... symptoms become debilitating. , The findings of the ... online in the journal Molecular Psychiatry . ...
Breaking Biology News(10 mins):Fueling fitness on the final frontier 221st European Biomass Conference and Exhibition 221st European Biomass Conference and Exhibition 321st European Biomass Conference and Exhibition 4Genetic predictors of postpartum depression uncovered by Hopkins researchers 2Genetic predictors of postpartum depression uncovered by Hopkins researchers 3
Other Tags
deficitmammarymissilesguidedcoloradoinfluencesculturealoneopensdocumentedruinousmethamphtetamineflycheckfacedmetacognition