Tag: "would" at medical news

Reduced greenhouse gas emissions required to avoid dangerous increases in heat stress

...se gas emissions continues. The study found France would be subjected to the largest projected increase of ...ght expect that an average warming of four degrees would equate to each day warming by four degrees, but in fact the hottest days warm quite a bit more." T...

Paying taxes, according to the brain, can bring satisfaction

...r of psychology. I dont think that most economists would have suspected that. It reinforces the idea that t... voted to make other people pay the tax, too" That would help other people even more, so would the voter get a bigger neural reward" Harbaugh, Mayr and co-...

Weill Cornell Medical College announces gifts totaling $400M

... doctors and scientists of today and tomorrow. We would urge those who believe in the Weill Cornell mission to join us in making that difference in the medical discoveries of tomorrow." ...

Future therapies for stroke may block cell death

... use of histone deacetylase inhibitors in medicine would thus appear to hold tremendous promise," Kozikowski said. But to be clinically useful, he said, drugs must be designed that are able to discriminate between various forms of histone deacetylase. Kozikowski said the new findings, performed in colla...

Progress toward an antitumor vaccine

... chains made of polysaccharides. The modified MUC1 would be a good target molecule (antigen) for antibodies... protein by means of a spacer, explains Kunz. This would be very easy to accomplish with polysaccharides, but turns out to be very complicated with glycoprot...

Report calls for new directions, innovative approaches in testing chemicals for toxicity to humans

... Council. The report outlines a new approach that would rely less heavily on animal studies and instead fo...nts, preferably of human origin. The new approach would generate more-relevant data to evaluate risks people face, expand the number of chemicals that could...

Physician-researchers often less successful in obtaining NIH funding

...ted concerns that physician clinical investigators would become an 'endangered species' if trends continued unaltered," the authors write. There has been no comprehensive analysis over a long period of the outcomes for first-time investigators with an M.D. applying for research grants. Howard B. Dickler,...

Avian influenza on people's minds

...dy. The study focused on what American consumers would likely do if highly pathogenic H5N1 avian influenz...f infected poultry or eggs entering the food chain would be extremely low because of the rapid onset of symptoms in poultry as well as the safeguards in plac...

Split the difference: Pill-splitting study looks at cost-saving step that could be used by millions

...This study was done in part to see what the impact would be of having some of the cost savings go back to t...study, most participants said that reduced co-pays would be needed to entice them to continue splitting pills. The findings have already had an impact on o...

Simple test predicts 6-year risk of dementia

...res for all bedside risk factors plus factors that would be more difficult to measure as part of a routine clinical visit. These include brain magnetic resonance imaging (MRI) findings of enlarged ventricles the fluid-filled cavities between brain tissue -- or diseased white matter the nerve cells that t...

Alzheimer's disease to quadruple worldwide by 2050

...set of Alzheimers disease by as little as one year would reduce prevalence of the disease by 12 million few...th the onset and progression of Alzheimers disease would result in a smaller overall reduction of 9.2 million cases by 2050, because slower disease progressi...

Colonoscopy up in NYC

...es to push the rate to more than 80% by 2011. This would represent a doubling of the 2003 rate, and would bring screening rate closer to those for breast or cervical cancer....

Aging stem cells in mice may hold answers to diseases of the aged, Stanford study finds

...a, and are less likely to make new antibodies that would protect against infections like the flu," said senior author Irving Weissman, MD, director of the Stanford Institute for Stem Cell Biology and Regenerative Medicine and of the Stanford Comprehensive Cancer Center. The work will be published in the Ju...

Surgery by satellite -- New possibilities at medicine's cutting edge

.... The team thinks that virtual reality prediction would also greatly aid this type of surgery. This is an exciting next step forward in developing telesurgery, which holds the promise of many new efficient and cost-effective ways of providing advanced healthcare services, says project leader Reiza Rayma...

High-Need Physician Workforce Incentives Act endorsed by American College of Physicians

...neral physicians in high-need areas. The proposal would empower the Health Resources and Services Administ...ss today also introduced two other bills, one that would create a pathway to eliminating Medicare cuts from the Sustainable Growth Rate (SGR) Formula and ano...

New study reports hotel guests at risk from carbon monoxide poisoning

...lifetime risk to individuals who travel frequently would be higher. This risk could approach zero with effective CO prevention measures. The authors contacted 43 sites where CO poisonings had occurred and found that only 12% had installed CO detectors after the incidents. In 101 sites where no CO poison...

UGA study finds that violence costs nation $70 billion annually

... they measure the contribution that the individual would have made through his or her work. The researchers note that there are several programs that have been proven to reduce violence. Students participating in school-based programs that include a focus on enhancing academic progress and problem-solvin...

Smokers given more help to quit since GP performance pay introduced

...linical Excellence) guidance says, and that's what would be best forsmokers and best for the NHS."...

Folic acid supplements do not appear to reduce risk of colorectal tumors

... primary prevention trials that start in childhood would be lengthy, expensive, and logistically nearly impossible." "The results of the clinical trial by Cole et al illustrate, yet again, the principle that chemoprevention with single agents is problematic. Similar to the increased risk of lung cancer o...

Performance-related financial incentives for hospitals not linked with improved quality of care

...ng hospitals with the highest performance measures would receive a reimbursement bonus, while those with the poorest performance risked future financial penalty. Seth W. Glickman, M.D., M.B.A., of Duke University Medical Center, Durham, N.C., and colleagues examined whether hospitals participating in the...

1 2 3 4 5 6 7 8 9 10

(Date:11/12/2014)... 12, 2014 Crossmatch™, a leading provider of ... ® fingerprint readers have been deployed throughout Montparnasse ... Central Mexico . The bakery chain implemented the ... issues caused by employees clocking in for each other. ... readers, Montparnasse relied on paper timecards and a mechanical ...
(Date:11/7/2014)... Dr. Debra Auguste, associate professor, biomedical engineering, in ... College of New York, have identified a molecule ... of the most aggressive forms of breast cancer. ... high mortality rate owing to aggressive proliferation and ... However, Professor Auguste,s team, discovered the overexpression of ...
(Date:11/6/2014)... groundbreaking paper from a team of Florida State University ... plants could adapt to and survive environmental swings such ... the latest issue of the journal The Plant ... of DNA and proteins) is organized in a cell ... genes are turned on and others are turned off. ...
Breaking Biology News(10 mins):Montparnasse Pasteleria Achieves Time and Attendance Transparency with Crossmatch U.are.U Fingerprint Readers 2Maize analysis yields whole new world of genetic science 2
Other Tags
bloomduecorpsesmellyvalvesimplifyarisingschrenkinsurancecirrhosiscelecoxibtooculpritfindresearchersstanford